Recombinant Full Length Human CHGA Protein, C-Flag-tagged
Cat.No. : | CHGA-1353HFL |
Product Overview : | Recombinant Full Length Human CHGA Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. It is found in secretory vesicles of neurons and endocrine cells. This gene product is a precursor to three biologically active peptides; vasostatin, pancreastatin, and parastatin. These peptides act as autocrine or paracrine negative modulators of the neuroendocrine system. Two other peptides, catestatin and chromofungin, have antimicrobial activity and antifungal activity, respectively. Two transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 48.9 kDa |
AA Sequence : | MRSAAVLALLLCAGQVTALPVNSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETLRGDERILSIL RHQNLLKELQDLALQGAKERAHQQKKHSGFEDELSEVLENQSSQAELKEAVEEPSSKDVMEKREDSKEAE KSGEATDGARPQALPEPMQESKAEGNNQAPGEEEEEEEEATNTHPPASLPSQKYPGPQAEGDSEGLSQGL VDREKGLSAEPGWQAKREEEEEEEEEAEAGEEAVPEEEGPTVVLNPHPSLGYKEIRKGESRSEALAVDGA GKPGAEEAQDPEGKGEQEHSQQKEEEEEMAVVPQGLFRGGKSGELEQEEERLSKEWEDSKRWSKMDQLAK ELTAEKRLEGQEEEEDNRDSSMKLSFRARAYGFRGPGPQLRRGWRPSSREDSLEAGLPLQVRGYPEEKKE EEGSANRRPEDQELESLSAIEAELEKVAHQLQALRRGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein |
Full Length : | Full L. |
Gene Name | CHGA chromogranin A [ Homo sapiens (human) ] |
Official Symbol | CHGA |
Synonyms | CGA; PHE5; PHES |
Gene ID | 1113 |
mRNA Refseq | NM_001275.4 |
Protein Refseq | NP_001266.1 |
MIM | 118910 |
UniProt ID | P10645 |
◆ Recombinant Proteins | ||
CHGA-26908TH | Recombinant Human CHGA | +Inquiry |
CHGA-1360H | Recombinant Human CHGA Protein (19-457 aa), His-tagged | +Inquiry |
CHGA-5815P | Recombinant Pig CHGA protein, His-tagged | +Inquiry |
CHGA-669R | Recombinant Rhesus Macaque CHGA Protein, His (Fc)-Avi-tagged | +Inquiry |
CHGA-033H | Recombinant Human Chromogranin A (Parathyroid Secretory Protein 1), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHGA-7540HCL | Recombinant Human CHGA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CHGA Products
Required fields are marked with *
My Review for All CHGA Products
Required fields are marked with *
0
Inquiry Basket