Recombinant Full Length Human CHIC2 Protein, GST-tagged
Cat.No. : | CHIC2-3198HF |
Product Overview : | Human CHIC2 full-length ORF (AAH34691, 1 a.a. - 165 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 165 amino acids |
Description : | This gene encodes a member of the CHIC family of proteins. The encoded protein contains a cysteine-rich hydrophobic (CHIC) motif, and is localized to vesicular structures and the plasma membrane. This gene is associated with some cases of acute myeloid leukemia. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 43.78 kDa |
AA Sequence : | MADFDEIYEEEEDEERALEEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASINRVNSCLKKNLPVNVRWLLCGCLCCCCTLGCSMWPVICLSKRTRRSIEKLLEWENNRLYHKLCLHWRLSKRKCETNNMMEYVILIEFLPKTPIFRPD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CHIC2 cysteine-rich hydrophobic domain 2 [ Homo sapiens ] |
Official Symbol | CHIC2 |
Synonyms | CHIC2; cysteine-rich hydrophobic domain 2; cysteine-rich hydrophobic domain 2 protein; BTL; BRX-like translocated in leukemia; cystein-rich hydrophobic domain 2; MGC21173; |
Gene ID | 26511 |
mRNA Refseq | NM_012110 |
Protein Refseq | NP_036242 |
MIM | 604332 |
UniProt ID | Q9UKJ5 |
◆ Recombinant Proteins | ||
CHIC2-3198HF | Recombinant Full Length Human CHIC2 Protein, GST-tagged | +Inquiry |
Chic2-2143M | Recombinant Mouse Chic2 Protein, Myc/DDK-tagged | +Inquiry |
CHIC2-1235H | Recombinant Human CHIC2 Protein, GST-Tagged | +Inquiry |
CHIC2-3396M | Recombinant Mouse CHIC2 Protein | +Inquiry |
CHIC2-11342Z | Recombinant Zebrafish CHIC2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHIC2-7537HCL | Recombinant Human CHIC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CHIC2 Products
Required fields are marked with *
My Review for All CHIC2 Products
Required fields are marked with *
0
Inquiry Basket