Recombinant Full Length Human CHIC2 Protein, GST-tagged

Cat.No. : CHIC2-3198HF
Product Overview : Human CHIC2 full-length ORF (AAH34691, 1 a.a. - 165 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 165 amino acids
Description : This gene encodes a member of the CHIC family of proteins. The encoded protein contains a cysteine-rich hydrophobic (CHIC) motif, and is localized to vesicular structures and the plasma membrane. This gene is associated with some cases of acute myeloid leukemia. [provided by RefSeq, Jul 2008]
Molecular Mass : 43.78 kDa
AA Sequence : MADFDEIYEEEEDEERALEEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASINRVNSCLKKNLPVNVRWLLCGCLCCCCTLGCSMWPVICLSKRTRRSIEKLLEWENNRLYHKLCLHWRLSKRKCETNNMMEYVILIEFLPKTPIFRPD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CHIC2 cysteine-rich hydrophobic domain 2 [ Homo sapiens ]
Official Symbol CHIC2
Synonyms CHIC2; cysteine-rich hydrophobic domain 2; cysteine-rich hydrophobic domain 2 protein; BTL; BRX-like translocated in leukemia; cystein-rich hydrophobic domain 2; MGC21173;
Gene ID 26511
mRNA Refseq NM_012110
Protein Refseq NP_036242
MIM 604332
UniProt ID Q9UKJ5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHIC2 Products

Required fields are marked with *

My Review for All CHIC2 Products

Required fields are marked with *

0
cart-icon