Recombinant Full Length Human CHRNB3 Protein, GST-tagged
Cat.No. : | CHRNB3-3261HF |
Product Overview : | Human CHRNB3 full-length ORF (NP_000740.1, 1 a.a. - 458 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 458 amino acids |
Description : | The nicotinic acetylcholine receptors (nAChRs) are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The nAChRs are (hetero)pentamers composed of homologous subunits. The subunits that make up the muscle and neuronal forms of nAChRs are encoded by separate genes and have different primary structure. There are several subtypes of neuronal nAChRs that vary based on which homologous subunits are arranged around the central channel. They are classified as alpha-subunits if, like muscle alpha-1 (MIM 100690), they have a pair of adjacent cysteines as part of the presumed acetylcholine binding site. Subunits lacking these cysteine residues are classified as beta-subunits (Groot Kormelink and Luyten, 1997 [PubMed 9009220]). Elliott et al. (1996) [PubMed 8906617] stated that the proposed structure for each subunit is a conserved N-terminal extracellular domain followed by 3 conserved transmembrane domains, a variable cytoplasmic loop, a fourth conserved transmembrane domain, and a short C-terminal extracellular region.[supplied by OMIM, Apr 2010] |
Molecular Mass : | 79.1 kDa |
AA Sequence : | MLPDFMLVLIVLGIPSSATTGFNSIAENEDALLRHLFQGYQKWVRPVLHSNDTIKVYFGLKISQLVDVDEKNQLMTTNVWLKQEWTDHKLRWNPDDYGGIHSIKVPSESLWLPDIVLFENADGRFEGSLMTKVIVKSNGTVVWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSWTYDGTMVDLILINENVDRKDFFDNGEWEILNAKGMKGNRRDGVYSYPFITYSFVLRRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIVTVFVINVHHRSSSTYHPMAPWVKRLFLQKLPKLLCMKDHVDRYSSPEKEESQPVVKGKVLEKKKQKQLSDGEKVLVAFLEKAADSIRYISRHVKKEHFISQVVQDWKFVAQVLDRIFLWLFLIVSVTGSVLIFTPALKMWLHSYH |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CHRNB3 cholinergic receptor, nicotinic, beta 3 (neuronal) [ Homo sapiens ] |
Official Symbol | CHRNB3 |
Synonyms | CHRNB3; cholinergic receptor, nicotinic, beta 3 (neuronal); cholinergic receptor, nicotinic, beta polypeptide 3; neuronal acetylcholine receptor subunit beta-3; acetylcholine receptor; nicotinic; beta 3 (neuronal); acetylcholine receptor, nicotinic, beta 3 (neuronal); acetylcholine receptor, neuronal nicotinic, beta-3 subunit; |
Gene ID | 1142 |
mRNA Refseq | NM_000749 |
Protein Refseq | NP_000740 |
MIM | 118508 |
UniProt ID | Q05901 |
◆ Recombinant Proteins | ||
CHRNB3-1729H | Recombinant Human CHRNB3 Protein (Ile25-Leu232), C-His tagged | +Inquiry |
CHRNB3-673H | Recombinant Human CHRNB3 Protein, His-tagged | +Inquiry |
CHRNB3-6375C | Recombinant Chicken CHRNB3 | +Inquiry |
CHRNB3-3440M | Recombinant Mouse CHRNB3 Protein | +Inquiry |
CHRNB3-672H | Recombinant Human CHRNB3 Protein, Fc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHRNB3 Products
Required fields are marked with *
My Review for All CHRNB3 Products
Required fields are marked with *
0
Inquiry Basket