Recombinant Full Length Human CIAPIN1 Protein, GST-tagged

Cat.No. : CIAPIN1-1839HF
Product Overview : Human CIAPIN1 full-length ORF ( NP_064709.2, 1 a.a. - 312 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 312 amino acids
Description : CIAPIN1 is a cytokine-induced inhibitor of apoptosis with no relation to apoptosis regulatory molecules of the BCL2 (MIM 151430) or CASP (see MIM 147678) families. Expression of CIAPIN1 is dependent on growth factor stimulation (Shibayama et al., 2004 [PubMed 14970183]).[supplied by OMIM, Mar 2008]
Molecular Mass : 60 kDa
AA Sequence : MADFGISAGQFVAVVWDKSSPVEALKGLVDKLQALTGNEGRVSVENIKQLLQSAHKESSFDIILSGLVPGSTTLHSAEILAEIARILRPGGCLFLKEPVETAVDNNSKVKTASKLCSALTLSGLVEVKELQREPLTPEEVQSVREHLGHESDNLLFVQITGKKPNFEVGSSRQLKLSITKKSSPSVKPAVDPAAAKLWTLSANDMEDDSMDLIDSDELLDPEDLKKPDPASLRAASCGEGKKRKACKNCTCGLAEELEKEKSREQMSSQPKSACGNCYLGDAFRCASCPYLGMPAFKPGEKVLLSDSNLHDA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CIAPIN1 cytokine induced apoptosis inhibitor 1 [ Homo sapiens ]
Official Symbol CIAPIN1
Synonyms CIAPIN1; cytokine induced apoptosis inhibitor 1; anamorsin; Anamorsin; predicted protein of HQ0915; cytokine-induced apoptosis inhibitor 1; fe-S cluster assembly protein DRE2 homolog; DRE2; PRO0915; 2810413N20Rik
Gene ID 57019
mRNA Refseq NM_020313
Protein Refseq NP_064709
MIM 608943
UniProt ID Q6FI81

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CIAPIN1 Products

Required fields are marked with *

My Review for All CIAPIN1 Products

Required fields are marked with *

0
cart-icon
0
compare icon