Recombinant Full Length Human CIAPIN1 Protein, GST-tagged
Cat.No. : | CIAPIN1-1839HF |
Product Overview : | Human CIAPIN1 full-length ORF ( NP_064709.2, 1 a.a. - 312 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 312 amino acids |
Description : | CIAPIN1 is a cytokine-induced inhibitor of apoptosis with no relation to apoptosis regulatory molecules of the BCL2 (MIM 151430) or CASP (see MIM 147678) families. Expression of CIAPIN1 is dependent on growth factor stimulation (Shibayama et al., 2004 [PubMed 14970183]).[supplied by OMIM, Mar 2008] |
Molecular Mass : | 60 kDa |
AA Sequence : | MADFGISAGQFVAVVWDKSSPVEALKGLVDKLQALTGNEGRVSVENIKQLLQSAHKESSFDIILSGLVPGSTTLHSAEILAEIARILRPGGCLFLKEPVETAVDNNSKVKTASKLCSALTLSGLVEVKELQREPLTPEEVQSVREHLGHESDNLLFVQITGKKPNFEVGSSRQLKLSITKKSSPSVKPAVDPAAAKLWTLSANDMEDDSMDLIDSDELLDPEDLKKPDPASLRAASCGEGKKRKACKNCTCGLAEELEKEKSREQMSSQPKSACGNCYLGDAFRCASCPYLGMPAFKPGEKVLLSDSNLHDA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CIAPIN1 cytokine induced apoptosis inhibitor 1 [ Homo sapiens ] |
Official Symbol | CIAPIN1 |
Synonyms | CIAPIN1; cytokine induced apoptosis inhibitor 1; anamorsin; Anamorsin; predicted protein of HQ0915; cytokine-induced apoptosis inhibitor 1; fe-S cluster assembly protein DRE2 homolog; DRE2; PRO0915; 2810413N20Rik |
Gene ID | 57019 |
mRNA Refseq | NM_020313 |
Protein Refseq | NP_064709 |
MIM | 608943 |
UniProt ID | Q6FI81 |
◆ Recombinant Proteins | ||
Ciapin1-397M | Recombinant Mouse Ciapin1 Protein, MYC/DDK-tagged | +Inquiry |
CIAPIN1-1354H | Recombinant Human CIAPIN1 Protein, GST-tagged | +Inquiry |
CIAPIN1-1269C | Recombinant Chicken CIAPIN1 | +Inquiry |
CIAPIN1-1685M | Recombinant Mouse CIAPIN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CIAPIN1-4886H | Recombinant Human CIAPIN1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CIAPIN1-7500HCL | Recombinant Human CIAPIN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CIAPIN1 Products
Required fields are marked with *
My Review for All CIAPIN1 Products
Required fields are marked with *