Recombinant Full Length Human CIDEB Protein, GST-tagged
Cat.No. : | CIDEB-1849HF |
Product Overview : | Human CIDEB full-length ORF ( AAH35970, 1 a.a. - 219 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 219 amino acids |
Description : | CIDEB (Cell Death-Inducing DFFA-Like Effector B) is a Protein Coding gene. GO annotations related to this gene include identical protein binding. An important paralog of this gene is CIDEC. |
Molecular Mass : | 49.83 kDa |
AA Sequence : | MEYLSALNPSDLLRSVSNISSEFGRRVWTSAPPPQRPFRVCDHKRTIRKGLTAATRQELLAKALETLLLNGVLTLVLEEDGTAVDSEDFFQLLEDDTCLMVLQSGQSWSPTRSGVLSYGLGRERPKHSKDIARFTFDVYKQNPRDLFGSLNVKATFYGLYSMSCDFQGLGPKKVLRELLRWTSTLLQGLGHMLLGISSTLRHAVEGAEQWQQKGRLHSY |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CIDEB cell death-inducing DFFA-like effector b [ Homo sapiens ] |
Official Symbol | CIDEB |
Synonyms | CIDEB; cell death-inducing DFFA-like effector b; cell death activator CIDE-B |
Gene ID | 27141 |
mRNA Refseq | NM_014430 |
Protein Refseq | NP_055245 |
MIM | 604441 |
UniProt ID | Q9UHD4 |
◆ Recombinant Proteins | ||
CIDEB-11245H | Recombinant Human CIDEB, GST-tagged | +Inquiry |
CIDEB-1691M | Recombinant Mouse CIDEB Protein, His (Fc)-Avi-tagged | +Inquiry |
CIDEB-1362H | Recombinant Human CIDEB Protein, GST-tagged | +Inquiry |
CIDEB-878R | Recombinant Rhesus monkey CIDEB Protein, His-tagged | +Inquiry |
CIDEB-8147Z | Recombinant Zebrafish CIDEB | +Inquiry |
◆ Cell & Tissue Lysates | ||
CIDEB-7496HCL | Recombinant Human CIDEB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CIDEB Products
Required fields are marked with *
My Review for All CIDEB Products
Required fields are marked with *
0
Inquiry Basket