Recombinant Full Length Human CIRBP Protein
| Cat.No. : | CIRBP-82HF |
| Product Overview : | Recombinant full length Human CIRBP with N-terminal proprietary tag. Predicted MW 45.03kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 172 amino acids |
| Description : | Cold-inducible RNA-binding protein is a protein that in humans is encoded by the CIRBP gene. |
| Form : | Liquid |
| Molecular Mass : | 45.030kDa inclusive of tags |
| AA Sequence : | MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKD RETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVD QAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGD RGYGGNRFESRSGGYGGSRDYYSSRSQSGGYSDRSSGGSY RDSYDSYATHNE |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name | CIRBP cold inducible RNA binding protein [ Homo sapiens ] |
| Official Symbol | CIRBP |
| Synonyms | CIRBP; cold inducible RNA binding protein; cold-inducible RNA-binding protein; CIRP; Cold inducible RNA binding protein; glycine rich RNA binding protein |
| Gene ID | 1153 |
| mRNA Refseq | NM_001280 |
| Protein Refseq | NP_001271 |
| MIM | 602649 |
| UniProt ID | Q14011 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CIRBP Products
Required fields are marked with *
My Review for All CIRBP Products
Required fields are marked with *
