Recombinant Full Length Human CISD2 Protein, GST-tagged
Cat.No. : | CISD2-1855HF |
Product Overview : | Human CISD2 full-length ORF ( NP_001008389.1, 1 a.a. - 135 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 135 amino acids |
Description : | The protein encoded by this gene is a zinc finger protein that localizes to the endoplasmic reticulum. The encoded protein binds an iron/sulfur cluster and may be involved in calcium homeostasis. Defects in this gene are a cause of Wolfram syndrome 2. [provided by RefSeq, Mar 2011] |
Molecular Mass : | 41.7 kDa |
AA Sequence : | MVLESVARIVKVQLPAYLKRLPVPESITGFARLTVSEWLRLLPFLGVLALLGYLAVRPFLPKKKQQKDSLINLKIQKENPKVVNEINIEDLCLTKAAYCRCWRSKTFPACDGSHNKHNELTGDNVGPLILKKKEV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CISD2 CDGSH iron sulfur domain 2 [ Homo sapiens ] |
Official Symbol | CISD2 |
Synonyms | 1500009M05Rik; 1500026J14Rik; 1500031D15Rik; AI848398; B630006A20Rik; CDGSH iron sulfur domain 2; CDGSH iron-sulfur domain-containing protein 2; CDGSH type domain 2; CISD2; CISD2_HUMAN; Endoplasmic reticulum intermembrane small protein; ERIS; Miner1; MitoNEET related 1; MitoNEET-related 1 protein; NAF-1; Noxp70; Nutrient deprivation autophagy factor 1; Nutrient-deprivation autophagy factor-1; OTTHUMP00000219576; RGD1566242; WFS2; Zcd2; Zinc finger; Zinc finger, CDGSH type domain 2 |
Gene ID | 493856 |
mRNA Refseq | NM_001008388.4 |
Protein Refseq | NP_001008389.1 |
MIM | 611507 |
UniProt ID | Q8N5K1 |
◆ Recombinant Proteins | ||
CISD2-1379H | Recombinant Human CISD2 Protein, GST-tagged | +Inquiry |
CISD2-11254H | Recombinant Human CISD2, His-tagged | +Inquiry |
RFL33223LF | Recombinant Full Length Lithobates Catesbeiana Cdgsh Iron-Sulfur Domain-Containing Protein 2(Cisd2) Protein, His-Tagged | +Inquiry |
CISD2-1698M | Recombinant Mouse CISD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CISD2-301649H | Recombinant Human CISD2 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CISD2-7489HCL | Recombinant Human CISD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CISD2 Products
Required fields are marked with *
My Review for All CISD2 Products
Required fields are marked with *
0
Inquiry Basket