Recombinant Full Length Human CITED2 Protein, GST-tagged

Cat.No. : CITED2-1858HF
Product Overview : Human CITED2 full-length ORF ( NP_006070.2, 1 a.a. - 270 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 270 amino acids
Description : The protein encoded by this gene inhibits transactivation of HIF1A-induced genes by competing with binding of hypoxia-inducible factor 1-alpha to p300-CH1. Mutations in this gene are a cause of cardiac septal defects. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, May 2012]
Molecular Mass : 54.9 kDa
AA Sequence : MADHMMAMNHGRFPDGTNGLHHHPAHRMGMGQFPSPHHHQQQQPQHAFNALMGEHIHYGAGNMNATSGIRHAMGPGTVNGGHPPSALAPAARFNNSQFMGPPVASQGGSLPASMQLQKLNNQYFNHHPYPHNHYMPDLHPAAGHQMNGTNQHFRDCNPKHSGGSSTPGGSGGSSTPGGSGSSSGGGAGSSNSGGGSGSGNMPASVAHVPAAMLPPNVIDTDFIDEEVLMSLVIEMGLDRIKELPELWLGQNEFDFMTDFVCKQQPSRVSC
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CITED2 Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 2 [ Homo sapiens ]
Official Symbol CITED2
Synonyms CITED2; Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 2; cbp/p300-interacting transactivator 2; MRG1; MRG-1; MSG1-related gene 1; MSG-related protein 1; melanocyte-specific gene 1-related gene 1; ASD8; VSD2; P35SRJ
Gene ID 10370
mRNA Refseq NM_001168388
Protein Refseq NP_001161860
MIM 602937
UniProt ID Q99967

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CITED2 Products

Required fields are marked with *

My Review for All CITED2 Products

Required fields are marked with *

0
cart-icon
0
compare icon