Recombinant Full Length Human Cklf-Like Marvel Transmembrane Domain-Containing Protein 6(Cmtm6) Protein, His-Tagged
Cat.No. : | RFL24745HF |
Product Overview : | Recombinant Full Length Human CKLF-like MARVEL transmembrane domain-containing protein 6(CMTM6) Protein (Q9NX76) (1-183aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-183) |
Form : | Lyophilized powder |
AA Sequence : | MENGAVYSPTTEEDPGPARGPRSGLAAYFFMGRLPLLRRVLKGLQLLLSLLAFICEEVVS QCTLCGGLYFFEFVSCSAFLLSLLILIVYCTPFYERVDTTKVKSSDFYITLGTGCVFLLA SIIFVSTHDRTSAEIAAIVFGFIASFMFLLDFITMLYEKRQESQLRKPENTTRAEALTEP LNA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CMTM6 |
Synonyms | CMTM6; CKLFSF6; CKLF-like MARVEL transmembrane domain-containing protein 6; Chemokine-like factor superfamily member 6 |
UniProt ID | Q9NX76 |
◆ Recombinant Proteins | ||
CMTM6-931R | Recombinant Rhesus monkey CMTM6 Protein, His-tagged | +Inquiry |
RFL24745HF | Recombinant Full Length Human Cklf-Like Marvel Transmembrane Domain-Containing Protein 6(Cmtm6) Protein, His-Tagged | +Inquiry |
CMTM6-3637M | Recombinant Mouse CMTM6 Protein | +Inquiry |
CMTM6-1793M | Recombinant Mouse CMTM6 Protein, His (Fc)-Avi-tagged | +Inquiry |
Cmtm6-2212M | Recombinant Mouse Cmtm6 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CMTM6-7416HCL | Recombinant Human CMTM6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CMTM6 Products
Required fields are marked with *
My Review for All CMTM6 Products
Required fields are marked with *