Recombinant Full Length Human Claudin-9(Cldn9) Protein, His-Tagged
Cat.No. : | RFL22739HF |
Product Overview : | Recombinant Full Length Human Claudin-9(CLDN9) Protein (O95484) (1-217aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-217) |
Form : | Lyophilized powder |
AA Sequence : | MASTGLELLGMTLAVLGWLGTLVSCALPLWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTG QMQCKVYDSLLALPQDLQAARALCVIALLLALLGLLVAITGAQCTTCVEDEGAKARIVLT AGVILLLAGILVLIPVCWTAHAIIQDFYNPLVAEALKRELGASLYLGWAAAALLMLGGGL LCCTCPPPQVERPRGPRLGYSIPSRSGASGLDKRDYV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CLDN9 |
Synonyms | CLDN9; Claudin-9 |
UniProt ID | O95484 |
◆ Recombinant Proteins | ||
CLDN9-12HFL | Active Recombinant Full Length Human CLDN9 Protein, His-tagged | +Inquiry |
CLDN9-1074H | Recombinant Human CLDN9 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CLDN9-387H | Recombinant Human CLDN9 Full Length Transmembrane protein(VLPs) | +Inquiry |
CLDN9-13H | Active Recombinant Human CLDN9 protein, His-strep-tagged | +Inquiry |
CLDN9-3543M | Recombinant Mouse CLDN9 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLDN9-7457HCL | Recombinant Human CLDN9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLDN9 Products
Required fields are marked with *
My Review for All CLDN9 Products
Required fields are marked with *
0
Inquiry Basket