Recombinant Full Length Human CLDN12 Protein, GST-tagged
| Cat.No. : | CLDN12-2040HF |
| Product Overview : | Human CLDN12 full-length ORF ( AAH36754.1, 1 a.a. - 244 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 244 amino acids |
| Description : | This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. This gene is expressed in the inner ear and bladder epithelium, and it is over-expressed in colorectal carcinomas. This protein and claudin 2 are critical for vitamin D-dependent Ca2+ absorption between enterocytes. Multiple alternatively spliced transcript variants encoding the same protein have been found.[provided by RefSeq, Sep 2011] |
| Molecular Mass : | 52.58 kDa |
| AA Sequence : | MGCRDVHAATVLSFLCGIASVAGLFAGTLLPNWRKLRLITFNRNEKNLTVYTGLWVKCARYDGSSDCLMYDTTWYSSVDQLDLRVLQFALPLSMLIAMGALLLCLIGMCNTAFRSSVPNIKLAKCLVNSAGCHLVAGLLFFLAGTVSLSPSIWVIFYNIHLNKKFEPVFSFDYAVYVTIASAGGLFMTSLILFIWYCTCKSLPSPFWQPLYSHPPSMHTYSQPYSARSRLSAIEIDIPVVSHTT |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CLDN12 claudin 12 [ Homo sapiens ] |
| Official Symbol | CLDN12 |
| Synonyms | CLDN12; claudin 12; claudin-12 |
| Gene ID | 9069 |
| mRNA Refseq | NM_001185072 |
| Protein Refseq | NP_001172001 |
| MIM | 611232 |
| UniProt ID | P56749 |
| ◆ Recombinant Proteins | ||
| RFL8824MF | Recombinant Full Length Mouse Claudin-12(Cldn12) Protein, His-Tagged | +Inquiry |
| RFL30947BF | Recombinant Full Length Bovine Claudin-12(Cldn12) Protein, His-Tagged | +Inquiry |
| CLDN12-3523M | Recombinant Mouse CLDN12 Protein | +Inquiry |
| CLDN12-892R | Recombinant Rhesus monkey CLDN12 Protein, His-tagged | +Inquiry |
| RFL33695HF | Recombinant Full Length Human Claudin-12(Cldn12) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLDN12 Products
Required fields are marked with *
My Review for All CLDN12 Products
Required fields are marked with *
