Recombinant Full Length Human CLDN16 Protein, GST-tagged
Cat.No. : | CLDN16-2045HF |
Product Overview : | Human CLDN16 full-length ORF ( NP_006571.1, 1 a.a. - 305 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 305 amino acids |
Description : | Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. The protein encoded by this gene, a member of the claudin family, is an integral membrane protein and a component of tight junction strands. It is found primarily in the kidneys, specifically in the thick ascending limb of Henle, where it acts as either an intercellular pore or ion concentration sensor to regulate the paracellular resorption of magnesium ions. Defects in this gene are a cause of primary hypomagnesemia, which is characterized by massive renal magnesium wasting with hypomagnesemia and hypercalciuria, resulting in nephrocalcinosis and renal failure. This gene and the CLDN1 gene are clustered on chromosome 3q28. [provided by RefSeq, Jun 2010] |
Molecular Mass : | 60.2 kDa |
AA Sequence : | MTSRTPLLVTACLYYSYCNSRHLQQGVRKSKRPVFSHCQVPETQKTDTRHLSGARAGVCPCCHPDGLLATMRDLLQYIACFFAFFSAGFLIVATWTDCWMVNADDSLEVSTKCRGLWWECVTNAFDGIRTCDEYDSILAEHPLKLVVTRALMITADILAGFGFLTLLLGLDCVKFLPDEPYIKVRICFVAGATLLIAGTPGIIGSVWYAVDVYVERSTLVLHNIFLGIQYKFGWSCWLGMAGSLGCFLAGAVLTCCLYLFKDVGPERNYPYSLRKAYSAAGVSMAKSYSAPRTETAKMYAVDTRV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CLDN16 claudin 16 [ Homo sapiens ] |
Official Symbol | CLDN16 |
Synonyms | CLDN16; claudin 16; claudin-16; HOMG3; hypomagnesemia 3; with hypercalciuria and nephrocalcinosis; paracellin 1; PCLN1; PCLN-1; paracellin-1; hypomagnesemia 3, with hypercalciuria and nephrocalcinosis |
Gene ID | 10686 |
mRNA Refseq | NM_006580 |
Protein Refseq | NP_006571 |
MIM | 603959 |
UniProt ID | Q9Y5I7 |
◆ Recombinant Proteins | ||
CLDN16-1433R | Recombinant Rat CLDN16 Protein | +Inquiry |
RFL28330MF | Recombinant Full Length Mouse Claudin-16(Cldn16) Protein, His-Tagged | +Inquiry |
CLDN16-2045HF | Recombinant Full Length Human CLDN16 Protein, GST-tagged | +Inquiry |
CLDN16-1433H | Recombinant Human CLDN16 Protein, GST-tagged | +Inquiry |
RFL850RF | Recombinant Full Length Rat Claudin-16(Cldn16) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLDN16-7468HCL | Recombinant Human CLDN16 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLDN16 Products
Required fields are marked with *
My Review for All CLDN16 Products
Required fields are marked with *