Recombinant Full Length Human CLEC1A Protein, GST-tagged
| Cat.No. : | CLEC1A-2117HF |
| Product Overview : | Human CLEC1A full-length ORF ( AAH39072, 1 a.a. - 280 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 280 amino acids |
| Description : | This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signaling, glycoprotein turnover, and roles in inflammation and immune response. The encoded protein may play a role in regulating dendritic cell function. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014] |
| Molecular Mass : | 56.54 kDa |
| AA Sequence : | MQAKYSSTRDMLDDDGDTTMSLHSQGSATTRHPEPRRTEHRAPSSTWRPVALTLLTLCLVLLIGLAALGLLFFQYYQLSNTGQDTISQMEERLGNTSQELQSLQVQNIKLAGSLQHVAEKLCRELYNKAGAHRCSPRTEQWKWHGDNCYQFYKDSKSWEDCKYFCLSENSTMLKINKQEDLEFAASQSYSEFFYSYWTGLLRPDSGKAWLWMDGTPFTSELFHIIIDVTSPRSRDCVAILNGMIFSKDCKELKRCVCERRAGMVKPESLHVPPETLGEGD |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CLEC1A C-type lectin domain family 1, member A [ Homo sapiens ] |
| Official Symbol | CLEC1A |
| Synonyms | CLEC1A; C-type lectin domain family 1, member A; C-type lectin domain family 1 member A; CLEC1; MGC34328; CLEC-1; C-type lectin-like receptor-1 |
| Gene ID | 51267 |
| mRNA Refseq | NM_016511 |
| Protein Refseq | NP_057595 |
| MIM | 606782 |
| UniProt ID | Q8NC01 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLEC1A Products
Required fields are marked with *
My Review for All CLEC1A Products
Required fields are marked with *
