Recombinant Full Length Human CLEC4D Protein, GST-tagged

Cat.No. : CLEC4D-2159HF
Product Overview : Human CLEC4D full-length ORF ( AAH32313, 41 a.a. - 215 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 215 amino acids
Description : This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region. [provided by RefSeq, Jul 2008]
Molecular Mass : 44.99 kDa
AA Sequence : VTHHNFSRCKRGTGVHKLEHHAKLKCIKEKSELKSAEGSTWNCCPIDWRAFQSNCYFPLTDNKTWAESERNCSGMGAHLMTISTEAEQNFIIQFLDRRLSYFLGLRDENAKGQWRWVDQTPFNPRRVFWHKNEPDNSQGENCVVLVYNQDKWAWNDVPCNFEASRICKIPGTTLN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CLEC4D C-type lectin domain family 4, member D [ Homo sapiens ]
Official Symbol CLEC4D
Synonyms CLEC4D; C-type lectin domain family 4, member D; C type (calcium dependent, carbohydrate recognition domain) lectin, superfamily member 8 , CLECSF8; C-type lectin domain family 4 member D; Mpcl; C-type lectin receptor; macrophage C-type lectin; C-type lectin-like receptor 6; C-type lectin superfamily member 8; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 8; MCL; MPCL; CLEC6; CLEC-6; CLECSF8; MGC40078
Gene ID 338339
mRNA Refseq NM_080387
Protein Refseq NP_525126
MIM 609964
UniProt ID Q8WXI8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CLEC4D Products

Required fields are marked with *

My Review for All CLEC4D Products

Required fields are marked with *

0
cart-icon