Recombinant Full Length Human CLEC4D Protein, GST-tagged
Cat.No. : | CLEC4D-2159HF |
Product Overview : | Human CLEC4D full-length ORF ( AAH32313, 41 a.a. - 215 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 215 amino acids |
Description : | This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 44.99 kDa |
AA Sequence : | VTHHNFSRCKRGTGVHKLEHHAKLKCIKEKSELKSAEGSTWNCCPIDWRAFQSNCYFPLTDNKTWAESERNCSGMGAHLMTISTEAEQNFIIQFLDRRLSYFLGLRDENAKGQWRWVDQTPFNPRRVFWHKNEPDNSQGENCVVLVYNQDKWAWNDVPCNFEASRICKIPGTTLN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CLEC4D C-type lectin domain family 4, member D [ Homo sapiens ] |
Official Symbol | CLEC4D |
Synonyms | CLEC4D; C-type lectin domain family 4, member D; C type (calcium dependent, carbohydrate recognition domain) lectin, superfamily member 8 , CLECSF8; C-type lectin domain family 4 member D; Mpcl; C-type lectin receptor; macrophage C-type lectin; C-type lectin-like receptor 6; C-type lectin superfamily member 8; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 8; MCL; MPCL; CLEC6; CLEC-6; CLECSF8; MGC40078 |
Gene ID | 338339 |
mRNA Refseq | NM_080387 |
Protein Refseq | NP_525126 |
MIM | 609964 |
UniProt ID | Q8WXI8 |
◆ Recombinant Proteins | ||
CLEC4D-3209H | Recombinant Human CLEC4D protein(Gly52-Asn215), His-tagged | +Inquiry |
CLEC4D-2159HF | Recombinant Full Length Human CLEC4D Protein, GST-tagged | +Inquiry |
CLEC4D-2491H | Recombinant Human CLEC4D Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Clec4d-16R | Recombinant Rat Clec4d, Fc tagged | +Inquiry |
CLEC4D-1101R | Recombinant Rat CLEC4D Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLEC4D-1487RCL | Recombinant Rat CLEC4D cell lysate | +Inquiry |
CLEC4D-2242HCL | Recombinant Human CLEC4D cell lysate | +Inquiry |
CLEC4D-1006RCL | Recombinant Rat CLEC4D cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLEC4D Products
Required fields are marked with *
My Review for All CLEC4D Products
Required fields are marked with *