Recombinant Full Length Human CLEC4E Protein, GST-tagged

Cat.No. : CLEC4E-2160HF
Product Overview : Human CLEC4E full-length ORF ( AAH00715, 1 a.a. - 219 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 219 amino acids
Description : This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type II transmembrane protein is a downstream target of CCAAT/enhancer binding protein (C/EBP), beta (CEBPB) and may play a role in inflammation. Alternative splice variants have been described but their full-length sequence has not been determined. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region. [provided by RefSeq, Jul 2008]
Molecular Mass : 49.83 kDa
AA Sequence : MNSSKSSETQCTERGCFSSQMFLWTVAGIPILFLSACFITRCVVTFRIFQTCDEKKFQLPENFTELSCYNYGSGSVKNCCPLNWEYFQSSCYFFSTDTISWALSLKNCSAMGAHLVVINSQEEQEFLSYKKPKMREFFIGLSDQVVEGQWQWVDGTPLTKSLSFWDVGEPNNIATLEDCATMRDSSNPRQNWNDVTCFLNYFRICEMVGINPLNKGKSL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CLEC4E C-type lectin domain family 4, member E [ Homo sapiens ]
Official Symbol CLEC4E
Synonyms CLEC4E; C-type lectin domain family 4, member E; C type (calcium dependent, carbohydrate recognition domain) lectin, superfamily member 9 , CLECSF9; C-type lectin domain family 4 member E; mincle; C-type lectin superfamily member 9; macrophage-inducible C-type lectin; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 9; MINCLE; CLECSF9
Gene ID 26253
mRNA Refseq NM_014358
Protein Refseq NP_055173
MIM 609962
UniProt ID Q9ULY5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CLEC4E Products

Required fields are marked with *

My Review for All CLEC4E Products

Required fields are marked with *

0
cart-icon