Recombinant Full Length Human CLN3 Protein, C-Flag-tagged
Cat.No. : | CLN3-1022HFL |
Product Overview : | Recombinant Full Length Human CLN3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a protein that is involved in lysosomal function. Mutations in this, as well as other neuronal ceroid-lipofuscinosis (CLN) genes, cause neurodegenerative diseases commonly known as Batten disease or collectively known as neuronal ceroid lipofuscinoses (NCLs). Many alternatively spliced transcript variants have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 47.4 kDa |
AA Sequence : | MGGCAGSRRRFSDSEGEETVPEPRLPLLDHQGAHWKNAVGFWLLGLCNNFSYVVMLSAAHDILSHKRTSG NQSHVDPGPTPIPHNSSSRFDCNSVSTAAVLLADILPTLVIKLLAPLGLHLLPYSPRVLVSGICAAGSFV LVAFSHSVGTSLCGVVFASISSGLGEVTFLSLTAFYPRAVISWWSSGTGGAGLLGALSYLGLTQAGLSPQ QTLLSMLGIPALLLASYFLLLTSPEAQDPGGEEEAESAARQPLIRTEAPESKPGSSSSLSLRERWTVFKG LLWYIVPLVVVYFAEYFINQGLFELLFFWNTSLSHAQQYRWYQMLYQAGVFASRSSLRCCRIRFTWALAL LQCLNLVFLLADVWFGFLPSIYLVFLIILYEGLLGGAAYVNTFHNIALETSDEHREFAMAATCISDTLGI SLSGLLALPLHDFLCQLSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Protein Pathways : | Lysosome |
Full Length : | Full L. |
Gene Name | CLN3 CLN3 lysosomal/endosomal transmembrane protein, battenin [ Homo sapiens (human) ] |
Official Symbol | CLN3 |
Synonyms | BTS; BTN1; JNCL |
Gene ID | 1201 |
mRNA Refseq | NM_001042432.2 |
Protein Refseq | NP_001035897.1 |
MIM | 607042 |
UniProt ID | Q13286 |
◆ Recombinant Proteins | ||
CLN3-158C | Recombinant Cynomolgus Monkey CLN3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CLN3-3252H | Recombinant Human CLN3 Protein, MYC/DDK-tagged | +Inquiry |
CLN3-410C | Recombinant Cynomolgus CLN3 Protein, His-tagged | +Inquiry |
CLN3-1880HF | Recombinant Full Length Human CLN3 Protein, GST-tagged | +Inquiry |
CLN3-1505H | Recombinant Human CLN3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLN3-367HCL | Recombinant Human CLN3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CLN3 Products
Required fields are marked with *
My Review for All CLN3 Products
Required fields are marked with *
0
Inquiry Basket