Recombinant Full Length Human CLUAP1 Protein, GST-tagged
Cat.No. : | CLUAP1-1895HF |
Product Overview : | Human CLUAP1 full-length ORF ( NP_079069.1, 1 a.a. - 247 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 247 amino acids |
Description : | The protein encoded by this gene contains a single coiled-coil region. Alternative splicing results in multiple transcript variants and protein isoforms. [provided by RefSeq, Jul 2012] |
Molecular Mass : | 55.5 kDa |
AA Sequence : | MRTEAIARPLEINETEKVMRIAIKEILTQVQKTKDLLNNVASDEANLEAKIEKRKLELERNRKRLETLQSVRPCFMDEYEKTEEELQKQYDTYLEKFQNLTYLEQQLEDHHRMEQERFEEAKNTLCLIQNKLKEEEKRLLKSGSNDDSDIDIQEDDESDSELEERRLPKPQTAMEMLMQGRPGKRIVGTMQGGDSDDNEDSEESEIDMEDDDDEDDDLEDESISLSPTKPNRRVRKSEPLDESDNDF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CLUAP1 clusterin associated protein 1 [ Homo sapiens ] |
Official Symbol | CLUAP1 |
Synonyms | CLUAP1; clusterin associated protein 1; clusterin-associated protein 1; FAP22; flagellar associated protein 22; qilin like protein; homolog (Chlamydomonas); FLJ13297; KIAA0643; flagellar associated protein 22, qilin-like protein, homolog |
Gene ID | 23059 |
mRNA Refseq | NM_015041 |
Protein Refseq | NP_055856 |
MIM | 616787 |
UniProt ID | Q96AJ1 |
◆ Recombinant Proteins | ||
Cluap1-2202M | Recombinant Mouse Cluap1 Protein, Myc/DDK-tagged | +Inquiry |
CLUAP1-3276H | Recombinant Human CLUAP1 Protein, DDK-tagged | +Inquiry |
CLUAP1-1473R | Recombinant Rat CLUAP1 Protein | +Inquiry |
CLUAP1-3278H | Recombinant Human CLUAP1 Protein, MYC/DDK-tagged | +Inquiry |
CLUAP1-1527H | Recombinant Human CLUAP1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CLUAP1 Products
Required fields are marked with *
My Review for All CLUAP1 Products
Required fields are marked with *
0
Inquiry Basket