Recombinant Full Length Human CLUAP1 Protein, GST-tagged

Cat.No. : CLUAP1-1895HF
Product Overview : Human CLUAP1 full-length ORF ( NP_079069.1, 1 a.a. - 247 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 247 amino acids
Description : The protein encoded by this gene contains a single coiled-coil region. Alternative splicing results in multiple transcript variants and protein isoforms. [provided by RefSeq, Jul 2012]
Molecular Mass : 55.5 kDa
AA Sequence : MRTEAIARPLEINETEKVMRIAIKEILTQVQKTKDLLNNVASDEANLEAKIEKRKLELERNRKRLETLQSVRPCFMDEYEKTEEELQKQYDTYLEKFQNLTYLEQQLEDHHRMEQERFEEAKNTLCLIQNKLKEEEKRLLKSGSNDDSDIDIQEDDESDSELEERRLPKPQTAMEMLMQGRPGKRIVGTMQGGDSDDNEDSEESEIDMEDDDDEDDDLEDESISLSPTKPNRRVRKSEPLDESDNDF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CLUAP1 clusterin associated protein 1 [ Homo sapiens ]
Official Symbol CLUAP1
Synonyms CLUAP1; clusterin associated protein 1; clusterin-associated protein 1; FAP22; flagellar associated protein 22; qilin like protein; homolog (Chlamydomonas); FLJ13297; KIAA0643; flagellar associated protein 22, qilin-like protein, homolog
Gene ID 23059
mRNA Refseq NM_015041
Protein Refseq NP_055856
MIM 616787
UniProt ID Q96AJ1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CLUAP1 Products

Required fields are marked with *

My Review for All CLUAP1 Products

Required fields are marked with *

0
cart-icon