Recombinant Full Length Human CMTM6 Protein, C-Flag-tagged
| Cat.No. : | CMTM6-1363HFL |
| Product Overview : | Recombinant Full Length Human CMTM6 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene is widely expressed in many tissues, but the exact function of the encoded protein is unknown. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 20.2 kDa |
| AA Sequence : | MENGAVYSPTTEEDPGPARGPRSGLAAYFFMGRLPLLRRVLKGLQLLLSLLAFICEEVVSQCTLCGGLYF FEFVSCSAFLLSLLILIVYCTPFYERVDTTKVKSSDFYITLGTGCVFLLASIIFVSTHDRTSAEIAAIVF GFIASFMFLLDFITMLYEKRQESQLRKPENTTRAEALTEPLNATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | Transmembrane |
| Full Length : | Full L. |
| Gene Name | CMTM6 CKLF like MARVEL transmembrane domain containing 6 [ Homo sapiens (human) ] |
| Official Symbol | CMTM6 |
| Synonyms | CKLFSF6; PRO2219 |
| Gene ID | 54918 |
| mRNA Refseq | NM_017801.3 |
| Protein Refseq | NP_060271.1 |
| MIM | 607889 |
| UniProt ID | Q9NX76 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CMTM6 Products
Required fields are marked with *
My Review for All CMTM6 Products
Required fields are marked with *
