Recombinant Full Length Human CMTM6 Protein, C-Flag-tagged
Cat.No. : | CMTM6-1363HFL |
Product Overview : | Recombinant Full Length Human CMTM6 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene is widely expressed in many tissues, but the exact function of the encoded protein is unknown. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 20.2 kDa |
AA Sequence : | MENGAVYSPTTEEDPGPARGPRSGLAAYFFMGRLPLLRRVLKGLQLLLSLLAFICEEVVSQCTLCGGLYF FEFVSCSAFLLSLLILIVYCTPFYERVDTTKVKSSDFYITLGTGCVFLLASIIFVSTHDRTSAEIAAIVF GFIASFMFLLDFITMLYEKRQESQLRKPENTTRAEALTEPLNATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Full Length : | Full L. |
Gene Name | CMTM6 CKLF like MARVEL transmembrane domain containing 6 [ Homo sapiens (human) ] |
Official Symbol | CMTM6 |
Synonyms | CKLFSF6; PRO2219 |
Gene ID | 54918 |
mRNA Refseq | NM_017801.3 |
Protein Refseq | NP_060271.1 |
MIM | 607889 |
UniProt ID | Q9NX76 |
◆ Recombinant Proteins | ||
CMTM6-3637M | Recombinant Mouse CMTM6 Protein | +Inquiry |
CMTM6-626H | Recombinant Human CMTM6 Protein, His (Fc)-Avi-tagged | +Inquiry |
CMTM6-1793M | Recombinant Mouse CMTM6 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL36042MF | Recombinant Full Length Mouse Cklf-Like Marvel Transmembrane Domain-Containing Protein 6(Cmtm6) Protein, His-Tagged | +Inquiry |
CMTM6-1908HF | Recombinant Full Length Human CMTM6 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CMTM6-7416HCL | Recombinant Human CMTM6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CMTM6 Products
Required fields are marked with *
My Review for All CMTM6 Products
Required fields are marked with *