Recombinant Full Length Human CMTM6 Protein, C-Flag-tagged

• Cat.No.: CMTM6-1363HFL
• Product Overview: Recombinant Full Length Human CMTM6 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene is widely expressed in many tissues, but the exact function of the encoded protein is unknown.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 20.2 kDa
• AA Sequence: MENGAVYSPTTEEDPGPARGPRSGLAAYFFMGRLPLLRRVLKGLQLLLSLLAFICEEVVSQCTLCGGLYF FEFVSCSAFLLSLLILIVYCTPFYERVDTTKVKSSDFYITLGTGCVFLLASIIFVSTHDRTSAEIAAIVF
  GFIASFMFLLDFITMLYEKRQESQLRKPENTTRAEALTEPLNATRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Transmembrane
• Full Length: Full L.

Gene Information

• Gene Name: CMTM6 CKLF like MARVEL transmembrane domain containing 6 [ Homo sapiens (human) ]
• Official Symbol: CMTM6
• Synonyms: CKLFSF6; PRO2219
• Gene ID: 54918
• mRNA Refseq: NM_017801.3
• Protein Refseq: NP_060271.1
• MIM: 607889
• UniProt ID: Q9NX76