Recombinant Full Length Human CNIH2 Protein, GST-tagged
Cat.No. : | CNIH2-1924HF |
Product Overview : | Human CNIH2 full-length ORF ( NP_872359.1, 1 a.a. - 160 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 160 amino acids |
Description : | The protein encoded by this gene is an auxiliary subunit of the ionotropic glutamate receptor of the AMPA subtype. AMPA receptors mediate fast synaptic neurotransmission in the central nervous system. This protein has been reported to interact with the Type I AMPA receptor regulatory protein isoform gamma-8 to control assembly of hippocampal AMPA receptor complexes, thereby modulating receptor gating and pharmacology. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012] |
Molecular Mass : | 45.3 kDa |
AA Sequence : | MAFTFAAFCYMLTLVLCASLIFFVIWHIIAFDELRTDFKNPIDQGNPARARERLKNIERICCLLRKLVVPEYSIHGLFCLMFLCAAEWVTLGLNIPLLFYHLWRYFHRPADGSEVMYDAVSIMNADILNYCQKESWCKLAFYLLSFFYYLYSMVYTLVSF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CNIH2 cornichon homolog 2 (Drosophila) [ Homo sapiens ] |
Official Symbol | CNIH2 |
Synonyms | Cnil; CNIH-2 |
Gene ID | 254263 |
mRNA Refseq | NM_182553.2 |
Protein Refseq | NP_872359.1 |
MIM | 611288 |
UniProt ID | Q6PI25 |
◆ Recombinant Proteins | ||
RFL1656DF | Recombinant Full Length Danio Rerio Protein Cornichon Homolog 2(Cnih2) Protein, His-Tagged | +Inquiry |
CNIH2-1560H | Recombinant Human CNIH2 Protein, GST-tagged | +Inquiry |
CNIH2-3261C | Recombinant Chicken CNIH2 | +Inquiry |
CNIH2-3651M | Recombinant Mouse CNIH2 Protein | +Inquiry |
CNIH2-4500H | Recombinant Human CNIH2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CNIH2-7409HCL | Recombinant Human CNIH2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CNIH2 Products
Required fields are marked with *
My Review for All CNIH2 Products
Required fields are marked with *
0
Inquiry Basket