Recombinant Full Length Human CNN1 Protein
| Cat.No. : | CNN1-89HF | 
| Product Overview : | Recombinant full length Human Calponin with N terminal proprietary tag; Predicted MWt 58.41 kDa, inclusive of tag. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Protein Length : | 297 amino acids | 
| Description : | Predicted to enable actin binding activity. Involved in negative regulation of vascular associated smooth muscle cell proliferation. Located in cytoskeleton. | 
| Form : | Liquid | 
| Molecular Mass : | 58.410kDa inclusive of tags | 
| AA Sequence : | MSSAHFNRGPAYGLSAEVKNKLAQKYDHQREQELREWIEG VTGRRIGNNFMDGLKDGIILCEFINKLQPGSVKKINES TQNWHQLENIGNFIKAITKYGVKPHDIFEANDLFENTNHT QVQSTLLALASMAKTKGNKVNVGVKYAEKQERKFEPGK LREGRNIIGLQMGTNKFASQQGMTAYGTRRHLYDPKLGTD QPLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLG MEHCDTLNVSLQMGSNKGASQRGMTVYGLPRQVYDPKYCL TPEYPELGEPAHNHHAHNYYNSA | 
| Purity : | Proprietary Purification | 
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. | 
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. | 
| Gene Name | CNN1 calponin 1, basic, smooth muscle [ Homo sapiens ] | 
| Official Symbol | CNN1 | 
| Synonyms | CNN1; calponin 1, basic, smooth muscle; calponin-1; Sm Calp; SMCC | 
| Gene ID | 1264 | 
| mRNA Refseq | NM_001299 | 
| Protein Refseq | NP_001290 | 
| MIM | 600806 | 
| UniProt ID | P51911 | 
| ◆ Recombinant Proteins | ||
| CNN1-2710H | Recombinant Human CNN1 protein, His-SUMO-tagged | +Inquiry | 
| CNN1-1750H | Recombinant Human CNN1 Protein, His-tagged | +Inquiry | 
| CNN1-3657H | Recombinant Human CNN1 protein, GST-tagged | +Inquiry | 
| CNN1-1566H | Recombinant Human CNN1 Protein, GST-tagged | +Inquiry | 
| CNN1-7065C | Recombinant Chicken CNN1 | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CNN1-7406HCL | Recombinant Human CNN1 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CNN1 Products
Required fields are marked with *
My Review for All CNN1 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            