Recombinant Full Length Human CNN1 Protein
Cat.No. : | CNN1-89HF |
Product Overview : | Recombinant full length Human Calponin with N terminal proprietary tag; Predicted MWt 58.41 kDa, inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 297 amino acids |
Description : | Predicted to enable actin binding activity. Involved in negative regulation of vascular associated smooth muscle cell proliferation. Located in cytoskeleton. |
Form : | Liquid |
Molecular Mass : | 58.410kDa inclusive of tags |
AA Sequence : | MSSAHFNRGPAYGLSAEVKNKLAQKYDHQREQELREWIEG VTGRRIGNNFMDGLKDGIILCEFINKLQPGSVKKINES TQNWHQLENIGNFIKAITKYGVKPHDIFEANDLFENTNHT QVQSTLLALASMAKTKGNKVNVGVKYAEKQERKFEPGK LREGRNIIGLQMGTNKFASQQGMTAYGTRRHLYDPKLGTD QPLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLG MEHCDTLNVSLQMGSNKGASQRGMTVYGLPRQVYDPKYCL TPEYPELGEPAHNHHAHNYYNSA |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | CNN1 calponin 1, basic, smooth muscle [ Homo sapiens ] |
Official Symbol | CNN1 |
Synonyms | CNN1; calponin 1, basic, smooth muscle; calponin-1; Sm Calp; SMCC |
Gene ID | 1264 |
mRNA Refseq | NM_001299 |
Protein Refseq | NP_001290 |
MIM | 600806 |
UniProt ID | P51911 |
◆ Recombinant Proteins | ||
CNN1-1750H | Recombinant Human CNN1 Protein, His-tagged | +Inquiry |
CNN1-1928HF | Recombinant Full Length Human CNN1 Protein, GST-tagged | +Inquiry |
CNN1-89HF | Recombinant Full Length Human CNN1 Protein | +Inquiry |
CNN1-6836H | Recombinant Human Calponin 1, Basic, Smooth Muscle, His-tagged | +Inquiry |
CNN1-1566H | Recombinant Human CNN1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CNN1-7406HCL | Recombinant Human CNN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CNN1 Products
Required fields are marked with *
My Review for All CNN1 Products
Required fields are marked with *