Recombinant Full Length Human CNN3 Protein, C-Flag-tagged
Cat.No. : | CNN3-680HFL |
Product Overview : | Recombinant Full Length Human CNN3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a protein with a markedly acidic C terminus; the basic N-terminus is highly homologous to the N-terminus of a related gene, CNN1. Members of the CNN gene family all contain similar tandemly repeated motifs. This encoded protein is associated with the cytoskeleton but is not involved in contraction. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 36.2 kDa |
AA Sequence : | MTHFNKGPSYGLSAEVKNKIASKYDHQAEEDLRNWIEEVTGMSIGPNFQLGLKDGIILCELINKLQPGSV KKVNESSLNWPQLENIGNFIKAIQAYGMKPHDIFEANDLFENGNMTQVQTTLVALAGLAKTKGFHTTIDI GVKYAEKQTRRFDEGKLKAGQSVIGLQMGTNKCASQAGMTAYGTRRHLYDPKMQTDKPFDQTTISLQMGT NKGASQAGMLAPGTRRDIYDQKLTLQPVDNSTISLQMGTNKVASQKGMSVYGLGRQVYDPKYCAAPTEPV IHNGSQGTGTNGSEISDSDYQAEYPDEYHGEYQDDYPRDYQYSDQGIDYTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | CNN3 calponin 3 [ Homo sapiens (human) ] |
Official Symbol | CNN3 |
Synonyms | calponin, acidic; calponin 3; calponin 3, acidic; dJ639P13.2.2 (acidic calponin 3) |
Gene ID | 1266 |
mRNA Refseq | NM_001839.5 |
Protein Refseq | NP_001830.1 |
MIM | 602374 |
UniProt ID | Q15417 |
◆ Recombinant Proteins | ||
CNN3-1149R | Recombinant Rat CNN3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CNN3-1569H | Recombinant Human CNN3 Protein, GST-tagged | +Inquiry |
CNN3-26293TH | Recombinant Human CNN3 | +Inquiry |
CNN3-629H | Recombinant Human CNN3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CNN3-1491R | Recombinant Rat CNN3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CNN3-7404HCL | Recombinant Human CNN3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CNN3 Products
Required fields are marked with *
My Review for All CNN3 Products
Required fields are marked with *
0
Inquiry Basket