Recombinant Full Length Human CNN3 Protein, GST-tagged
| Cat.No. : | CNN3-1930HF |
| Product Overview : | Human CNN3 full-length ORF ( NP_001830.1, 1 a.a. - 329 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 329 amino acids |
| Description : | This gene encodes a protein with a markedly acidic C terminus; the basic N-terminus is highly homologous to the N-terminus of a related gene, CNN1. Members of the CNN gene family all contain similar tandemly repeated motifs. This encoded protein is associated with the cytoskeleton but is not involved in contraction. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 62.8 kDa |
| AA Sequence : | MTHFNKGPSYGLSAEVKNKIASKYDHQAEEDLRNWIEEVTGMSIGPNFQLGLKDGIILCELINKLQPGSVKKVNESSLNWPQLENIGNFIKAIQAYGMKPHDIFEANDLFENGNMTQVQTTLVALAGLAKTKGFHTTIDIGVKYAEKQTRRFDEGKLKAGQSVIGLQMGTNKCASQAGMTAYGTRRHLYDPKMQTDKPFDQTTISLQMGTNKGASQAGMLAPGTRRDIYDQKLTLQPVDNSTISLQMGTNKVASQKGMSVYGLGRQVYDPKYCAAPTEPVIHNGSQGTGTNGSEISDSDYQAEYPDEYHGEYQDDYPRDYQYSDQGIDY |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CNN3 calponin 3, acidic [ Homo sapiens ] |
| Official Symbol | CNN3 |
| Synonyms | CNN3; calponin 3, acidic; calponin-3; calponin, acidic isoform; dJ639P13.2.2 (acidic calponin 3) |
| Gene ID | 1266 |
| mRNA Refseq | NM_001839 |
| Protein Refseq | NP_001830 |
| MIM | 602374 |
| UniProt ID | Q15417 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CNN3 Products
Required fields are marked with *
My Review for All CNN3 Products
Required fields are marked with *
