Recombinant Full Length Human CNOT6 Protein, GST-tagged

Cat.No. : CNOT6-1939HF
Product Overview : Human CNOT6 full-length ORF ( AAH27476.1, 1 a.a. - 92 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 92 amino acids
Description : This gene encodes the catalytic component of the CCR4-NOT core transcriptional regulation complex. The encoded protein has a 3'-5' RNase activity and prefers polyadenylated substrates. The CCR4-NOT complex plays a role in many cellular processes, including miRNA-mediated repression, mRNA degradation, and transcriptional regulation. [provided by RefSeq, Dec 2014]
Molecular Mass : 36.7 kDa
AA Sequence : MCIMTISSEGELELVGLMRLRKQLFLRSALCNHRSRELYGSGRGGALTHVVFVNGGCHLFIDAGTRVHLLDAKGLSFTQNVFICICYCLQYI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CNOT6 CCR4-NOT transcription complex, subunit 6 [ Homo sapiens ]
Official Symbol CNOT6
Synonyms CNOT6; CCR4-NOT transcription complex, subunit 6; CCR4-NOT transcription complex subunit 6; CCR4; KIAA1194; cytoplasmic deadenylase; carbon catabolite repression 4 protein; carbon catabolite repressor protein 4 homolog
Gene ID 57472
mRNA Refseq NM_015455
Protein Refseq NP_056270
MIM 608951
UniProt ID Q9ULM6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CNOT6 Products

Required fields are marked with *

My Review for All CNOT6 Products

Required fields are marked with *

0
cart-icon