Recombinant Full Length Human CNP Protein, C-Flag-tagged
Cat.No. : | CNP-1747HFL |
Product Overview : | Recombinant Full Length Human CNP Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Predicted to enable 2',3'-cyclic-nucleotide 3'-phosphodiesterase activity. Involved in substantia nigra development. Located in several cellular components, including extracellular space; microtubule; and plasma membrane. Implicated in hypomyelinating leukodystrophy 20; multiple sclerosis; and schizophrenia. Biomarker of alcoholic liver cirrhosis; multiple sclerosis; and restless legs syndrome. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 47.4 kDa |
AA Sequence : | MNRGFSRKSHTFLPKIFFRKMSSSGAKDKPELQFPFLQDEDTVATLLECKTLFILRGLPGSGKSTLARVI VDKYRDGTKMVSADAYKITPGARGAFSEEYKRLDEDLAAYCRRRDIRILVLDDTNHERERLEQLFEMADQ YQYQVVLVEPKTAWRLDCAQLKEKNQWQLSADDLKKLKPGLEKDFLPLYFGWFLTKKSSETLRKAGQVFL EELGNHKAFKKELRQFVPGDEPREKMDLVTYFGKRPPGVLHCTTKFCDYGKAPGAEEYAQQDVLKKSYSK AFTLTISALFVTPKTTGARVELSEQQLQLWPSDVDKLSPTDNLPRGSRAHITLGCAADVEAVQTGLDLLE ILRQEKGGSRGEEVGELSRGKLYSLGNGRWMLTLAKNMEVRAIFTGYYGKGKPVPTQGSRKGGALQSCTI ITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | CNP 2',3'-cyclic nucleotide 3' phosphodiesterase [ Homo sapiens (human) ] |
Official Symbol | CNP |
Synonyms | CNP1; HLD20 |
Gene ID | 1267 |
mRNA Refseq | NM_033133.5 |
Protein Refseq | NP_149124.3 |
MIM | 123830 |
UniProt ID | P09543 |
◆ Recombinant Proteins | ||
CNP-3532S | Recombinant Sumatran orangutan CNP protein, His&Myc-tagged | +Inquiry |
Cnp-478M | Recombinant Mouse Cnp Protein, His-tagged | +Inquiry |
CNP-768R | Recombinant Rhesus Macaque CNP Protein, His (Fc)-Avi-tagged | +Inquiry |
CNP-943R | Recombinant Rhesus monkey CNP Protein, His-tagged | +Inquiry |
CNP-1496R | Recombinant Rat CNP Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CNP-7397HCL | Recombinant Human CNP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CNP Products
Required fields are marked with *
My Review for All CNP Products
Required fields are marked with *
0
Inquiry Basket