Recombinant Full Length Human CNPY1 Protein, GST-tagged

• Cat.No.: CNPY1-1916HF
• Product Overview: Human CNPY1 full-length ORF (1 a.a. - 92 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 92 amino acids
• Description: Cnpy1 is expressed in the midbrain-hindbrain (MHB) boundary in zebrafish, binds FGFR1 (MIM 136350), and plays a role in FGF signaling (Hirate and Okamoto, 2006 [PubMed 16488878]).[supplied by OMIM, Dec 2008]
• Molecular Mass: 36.52 kDa
• AA Sequence: MNDYKLEEDPVTKERTFKRFAPRKGDKIYQEFKKLYFYSDAYRPLKFACETIIEEYEDEISSLIAQETHYLADKLCSEKSDLCETSANHTEL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CNPY1 canopy 1 homolog (zebrafish) [ Homo sapiens ]
• Official Symbol: CNPY1
• Synonyms: CNPY1; canopy 1 homolog (zebrafish); Canopy FGF Signaling Regulator 1; Canopy 1 Homolog (Zebrafish)
• Gene ID: 285888
• mRNA Refseq: NM_001103176.1
• Protein Refseq: NP_001096646.1
• MIM: 612493
• UniProt ID: Q3B7I2