Recombinant Full Length Human COA5 Protein, GST-tagged

Cat.No. : COA5-1994HF
Product Overview : Human COA5 full-length ORF ( ADR82642.1, 1 a.a. - 74 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 74 amino acids
Description : This gene encodes an ortholog of yeast Pet191, which in yeast is a subunit of a large oligomeric complex associated with the mitochondrial inner membrane, and required for the assembly of the cytochrome c oxidase complex. Mutations in this gene are associated with mitochondrial complex IV deficiency, a disorder of the mitochondrial respiratory chain with heterogeneous clinical manifestations, ranging from isolated myopathy to a severe disease affecting several tissues and organs. [provided by RefSeq, Dec 2011]
Molecular Mass : 8.2 kDa
AA Sequence : MPKYYEDKPQGGACAGLKEDLGACLLQSDCVVQEGKSPRQCLKEGYCNSLKYAFFECKRSVLDNRARFRGRKGY
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name COA5 cytochrome c oxidase assembly factor 5 [ Homo sapiens (human) ]
Official Symbol COA5
Synonyms COA5; cytochrome c oxidase assembly factor 5; Cytochrome C Oxidase Assembly Factor 5; C2orf64; Chromosome 2 Open Reading Frame 64; Protein C2orf64; 6330578E17Rik; CEMCOX3; Pet191; Pet191; C2orf64; CEMCOX3; 6330578E17Rik; cytochrome c oxidase assembly factor 5; protein C2orf64
Gene ID 493753
mRNA Refseq NM_001008215
Protein Refseq NP_001008216
MIM 613920
UniProt ID Q86WW8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All COA5 Products

Required fields are marked with *

My Review for All COA5 Products

Required fields are marked with *

0
cart-icon