Recombinant Full Length Human COMMD9 Protein, GST-tagged
| Cat.No. : | COMMD9-1946HF |
| Product Overview : | Human COMMD9 full-length ORF ( AAH10892.1, 1 a.a. - 198 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 198 amino acids |
| Description : | COMMD9 (COMM Domain Containing 9) is a Protein Coding gene. Among its related pathways are Innate Immune System. |
| Molecular Mass : | 48.2 kDa |
| AA Sequence : | MAALTAEHFAALQSLLKASSKDVVRQLCQESFSSSALGLKKLLDVTCSSLSVTQEEAEELLQALHRLTRLVAFRDLSSAEAILALFPENFHQNLKNLLTKIILEHVSTWRTEAQANQISLPRLVDLDWRVDIKTSSDSISRMAVPTCLLQMKIQEDPSLCGDKPSISAVTVELSKETLDTMLDGLGRIRDQLSAVASK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | COMMD9 COMM domain containing 9 [ Homo sapiens ] |
| Official Symbol | COMMD9 |
| Synonyms | HSPC166 |
| Gene ID | 29099 |
| mRNA Refseq | NM_014186.3 |
| Protein Refseq | NP_054905.2 |
| MIM | 612299 |
| UniProt ID | Q9P000 |
| ◆ Recombinant Proteins | ||
| Commd9-2254M | Recombinant Mouse Commd9 Protein, Myc/DDK-tagged | +Inquiry |
| COMMD9-1686H | Recombinant Human COMMD9 Protein, GST-tagged | +Inquiry |
| COMMD9-2711H | Recombinant Human COMMD9 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| COMMD9-7180H | Recombinant Human COMM Domain Containing 9, His-tagged | +Inquiry |
| COMMD9-5538Z | Recombinant Zebrafish COMMD9 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| COMMD9-7366HCL | Recombinant Human COMMD9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COMMD9 Products
Required fields are marked with *
My Review for All COMMD9 Products
Required fields are marked with *
