Recombinant Full Length Human COPS7A Protein, GST-tagged
Cat.No. : | COPS7A-1968HF |
Product Overview : | Human COPS7A full-length ORF ( NP_057403.1, 1 a.a. - 275 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 275 amino acids |
Description : | This gene encodes a component of the COP9 signalosome, an evolutionarily conserved multi-subunit protease that regulates the activity of the ubiquitin conjugation pathway. Alternatively spliced transcript variants that encode the same protein have been described. [provided by RefSeq, Mar 2014] |
Molecular Mass : | 56.7 kDa |
AA Sequence : | MSAEVKVTGQNQEQFLLLAKSAKGAALATLIHQVLEAPGVYVFGELLDMPNVRELAESDFASTFRLLTVFAYGTYADYLAEARNLPPLTEAQKNKLRHLSVVTLAAKVKCIPYAVLLEALALRNVRQLEDLVIEAVYADVLRGSLDQRNQRLEVDYSIGRDIQRQDLSAIARTLQEWCVGCEVVLSGIEEQVSRANQHKEQQLGLKQQIESEVANLKKTIKVTTAAAAAATSQDPEQHLTELREPAPGTNQRQPSKKASKGKGLRGSAKIWSKSN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | COPS7A COP9 constitutive photomorphogenic homolog subunit 7A (Arabidopsis) [ Homo sapiens ] |
Official Symbol | COPS7A |
Synonyms | COP9 signalosome complex subunit 7a; CSN7A; Dermal papilla derived protein 10; DERP10; JAB1 containing signalosome subunit 7a; SGN7a; Signalosome subunit 7a; COP9 signalosome complex subunit 7a; SGN7a; signalosome subunit 7a; COP9 complex subunit 7a; COP9 constitutive photomorphogenic homolog subunit 7A |
Gene ID | 50813 |
mRNA Refseq | NM_016319.2 |
Protein Refseq | NP_057403.1 |
MIM | 616009 |
UniProt ID | Q9UBW8 |
◆ Recombinant Proteins | ||
COPS7A-4870H | Recombinant Human COPS7A protein, His-SUMO-tagged | +Inquiry |
COPS7A-974R | Recombinant Rhesus monkey COPS7A Protein, His-tagged | +Inquiry |
COPS7A-159H | Recombinant Human COPS7A protein, His-tagged | +Inquiry |
COPS7A-3784M | Recombinant Mouse COPS7A Protein | +Inquiry |
COPS7A-1708H | Recombinant Human COPS7A Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COPS7A-384HCL | Recombinant Human COPS7A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COPS7A Products
Required fields are marked with *
My Review for All COPS7A Products
Required fields are marked with *