Recombinant Full Length Human COPS8 Protein, GST-tagged
| Cat.No. : | COPS8-1970HF |
| Product Overview : | Human COPS8 full-length ORF ( AAH03090, 1 a.a. - 209 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 209 amino acids |
| Description : | The protein encoded by this gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 48.73 kDa |
| AA Sequence : | MPVAVMAESAFSFKKLLDQCENQELEAPGGIATPPVYGQLLALYLLHNDMNNARYLWKRIPPAIKSANSELGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFALVSQAYTSIIADDFAAFVGLPVEEAVKGILEQGWQADSTTRMVLPRKPVAGALDVSFNKFIPLSEPAPVPPIPNEQQLARLTDYVAFLEN |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | COPS8 COP9 constitutive photomorphogenic homolog subunit 8 (Arabidopsis) [ Homo sapiens ] |
| Official Symbol | COPS8 |
| Synonyms | COPS8; COP9 constitutive photomorphogenic homolog subunit 8 (Arabidopsis); COP9 signalosome complex subunit 8; COP9; CSN8; MGC1297; SGN8; hCOP9; COP9 homolog; signalosome subunit 8; JAB1-containing signalosome subunit 8; MGC43256 |
| Gene ID | 10920 |
| mRNA Refseq | NM_006710 |
| Protein Refseq | NP_006701 |
| MIM | 616011 |
| UniProt ID | Q99627 |
| ◆ Recombinant Proteins | ||
| COPS8-1192R | Recombinant Rat COPS8 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Cops8-380M | Recombinant Mouse Cops8 Protein, MYC/DDK-tagged | +Inquiry |
| COPS8-4734H | Recombinant Human COP9 Signalosome Complex Subunit 8, His-tagged | +Inquiry |
| COPS8-3502C | Recombinant Chicken COPS8 | +Inquiry |
| COPS8-1535R | Recombinant Rat COPS8 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| COPS8-7352HCL | Recombinant Human COPS8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COPS8 Products
Required fields are marked with *
My Review for All COPS8 Products
Required fields are marked with *
