Recombinant Full Length Human CORO2A Protein, GST-tagged
Cat.No. : | CORO2A-1987HF |
Product Overview : | Human CORO2A full-length ORF ( AAH00010, 1 a.a. - 525 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 525 amino acids |
Description : | This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 5 WD repeats, and has a structural similarity with actin-binding proteins: the D. discoideum coronin and the human p57 protein, suggesting that this protein may also be an actin-binding protein that regulates cell motility. Alternative splicing of this gene generates 2 transcript variants. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 83.49 kDa |
AA Sequence : | MSWHPQYRSSKFRHVFGKPASKENCYDSVPITRSVHDNHFCAVNPHFIAVVTECAGGGAFLVIPLHQTGKLDPHYPKVCGHRGNVLDVKWNPFDDFEIASCSEDATIKIWSIPKQLLTRNLTAYRKELVGHARRVGLVEWHPTAANILFSAGYDYKVMIWNLDTKESVITSPMSTISCHQDVILSMSFNTNGSLLATTCKDRKIRVIDPRAGTVLQEASYKGHRASKVLFLGNLKKLMSTGTSRWNNRQVALWDQDNLSVPLMEEDLDGSSGVLFPFYDADTSMLYVVGKGDGNIRYYEVSADKPHLSYLTEYRSYNPQKGIGVMPKRGLDVSSCEIFRFYKLITTKSLIEPISMIVPRRSESYQEDIYPPTAGAQPSLTAQEWLSGMNRDPILVSLRPGSELLRPHPLPAERPIFNSMAPASPRLLNQTEKLAAEDGWRSSSLLEEKMPRWAAEHRLEEKKTWLTNGFDVFECPPPKTENELLQMFYRQQEEIRRLRELLTQREVQAKQLELEIKNLRMGSEQL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CORO2A coronin, actin binding protein, 2A [ Homo sapiens ] |
Official Symbol | CORO2A |
Synonyms | CORO2A; coronin, actin binding protein, 2A; coronin-2A; coronin 2A; coronin like protein B; IR10; WD protein IR10; WD repeat protein 2; WDR2; WD-repeat protein 2; coronin-like protein B; WD repeat-containing protein 2; coronin, actin-binding protein, 2A; CLIPINB; DKFZp686G19226 |
Gene ID | 7464 |
mRNA Refseq | NM_003389 |
Protein Refseq | NP_003380 |
MIM | 602159 |
UniProt ID | Q92828 |
◆ Recombinant Proteins | ||
CORO2A-1987HF | Recombinant Full Length Human CORO2A Protein, GST-tagged | +Inquiry |
CORO2A-2719H | Recombinant Human CORO2A Protein, His (Fc)-Avi-tagged | +Inquiry |
Coro2a-339M | Recombinant Mouse Coro2a Protein, MYC/DDK-tagged | +Inquiry |
CORO2A-579H | Recombinant Human CORO2A | +Inquiry |
CORO2A-3330H | Recombinant Human CORO2A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CORO2A-7341HCL | Recombinant Human CORO2A 293 Cell Lysate | +Inquiry |
CORO2A-7342HCL | Recombinant Human CORO2A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CORO2A Products
Required fields are marked with *
My Review for All CORO2A Products
Required fields are marked with *
0
Inquiry Basket