Recombinant Full Length Human CORO6 Protein, C-Flag-tagged
Cat.No. : | CORO6-1324HFL |
Product Overview : | Recombinant Full Length Human CORO6 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Predicted to enable actin filament binding activity. Predicted to be involved in actin filament organization and cell migration. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 52.8 kDa |
AA Sequence : | MSRRVVRQSKFRHVFGQAAKADQAYEDIRVSKVTWDSSFCAVNPKFLAIIVEAGGGGAFIVLPLAKTGRV DKNYPLVTGHTAPVLDIDWCPHNDNVIASASDDTTIMVWQIPDYTPMRNITEPIITLEGHSKRVGILSWH PTARNVLLSAGGDNVIIIWNVGTGEVLLSLDDMHPDVIHSVCWNSNGSLLATTCKDKTLRIIDPRKGQVV AERFAAHEGMRPMRAVFTRQGHIFTTGFTRMSQRELGLWDPNNFEEPVALQEMDTSNGVLLPFYDPDSSI VYLCGKGDSSIRYFEITDEPPFVHYLNTFSSKEPQRGMGFMPKRGLDVSKCEIARFYKLHERKCEPIIMT VPRKSDLFQDDLYPDTPGPEPALEADEWLSGQDAEPVLISLRDGYVPPKHRELRVTKRNILDVRPPSGPR RSQSASDAPLSQQHTLETLLEEIKALRERVQAQEQRITALENMLCELVDGTDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | CORO6 coronin 6 [ Homo sapiens (human) ] |
Official Symbol | CORO6 |
Synonyms | ClipinE |
Gene ID | 84940 |
mRNA Refseq | NM_032854.4 |
Protein Refseq | NP_116243.2 |
UniProt ID | Q6QEF8 |
◆ Recombinant Proteins | ||
CORO6-3306H | Recombinant Human CORO6 Protein, MYC/DDK-tagged | +Inquiry |
CORO6-3802M | Recombinant Mouse CORO6 Protein | +Inquiry |
CORO6-1988HF | Recombinant Full Length Human CORO6 Protein, GST-tagged | +Inquiry |
CORO6-1905M | Recombinant Mouse CORO6 Protein, His (Fc)-Avi-tagged | +Inquiry |
CORO6-2244H | Recombinant Human CORO6 Protein (Met1-Asp237), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CORO6-193HCL | Recombinant Human CORO6 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CORO6 Products
Required fields are marked with *
My Review for All CORO6 Products
Required fields are marked with *
0
Inquiry Basket