Recombinant Full Length Human CORT Protein, GST-tagged

Cat.No. : CORT-1989HF
Product Overview : Human CORT full-length ORF ( NP_001293.2, 1 a.a. - 155 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 155 amino acids
Description : This gene encodes a neuropeptide that is structurally similar to somatostatin. It binds to all known somatostatin receptors, and shares many pharmacological and functional properties with somatostatin, including the depression of neuronal activity. However, it also has many properties distinct from somatostatin, such as induction of slow-wave sleep, apparently by antagonism of the excitatory effects of acetylcholine on the cortex, reduction of locomotor activity, and activation of cation selective currents not responsive to somatostatin. The preproprotein undergoes further processing into multiple mature products. Read-through transcripts exist between this gene and the upstream APITD1 (apoptosis-inducing, TAF9-like domain 1) gene, as represented in GeneID:100526739. [provided by RefSeq, Nov 2010]
Molecular Mass : 43.6 kDa
AA Sequence : MYRHKNSWRLGLKYPPSSKEETQVPKTLISGLPGRKSSSRVGEKLQSAHKMPLSPGLLLLLLSGATATAALPLEGGPTGRDSEHMQEAAGIRKSSLLTFLAWWFEWTSQASAGPLIGEEAREVARRQEGAPPQQSARRDRMPCRNFFWKTFSSCK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CORT cortistatin [ Homo sapiens (human) ]
Official Symbol CORT
Synonyms CORT; cortistatin; Cortistatin; Prepro-Cortistatin; Preprocortistatin; Cortistatin-14; Cortistatin-17; Cortistatin-29; CST-14; CST-17; CST-29; cortistatin; cortistatin-14; cortistatin-17; cortistatin-29; prepro-cortistatin; preprocortistatin
Gene ID 1325
mRNA Refseq NM_001302
Protein Refseq NP_001293
MIM 602784
UniProt ID O00230

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CORT Products

Required fields are marked with *

My Review for All CORT Products

Required fields are marked with *

0
cart-icon
0
compare icon