Recombinant Full Length Human COX7A1 Protein, GST-tagged

Cat.No. : COX7A1-2014HF
Product Overview : Human COX7A1 full-length ORF ( AAH02757, 1 a.a. - 79 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 79 amino acids
Description : Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes polypeptide 1 (muscle isoform) of subunit VIIa and the polypeptide 1 is present only in muscle tissues. Other polypeptides of subunit VIIa are present in both muscle and nonmuscle tissues, and are encoded by different genes. [provided by RefSeq, Jul 2008]
Molecular Mass : 34.43 kDa
AA Sequence : MQALRVSQALIRSFSSTARNRFQNRVREKQKLFQEDNDIPLYLKGGIVDNILYRVTMTLCLGGTVYSLYSLGWASFPRN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name COX7A1 cytochrome c oxidase subunit 7A1 [ Homo sapiens (human) ]
Official Symbol COX7A1
Synonyms COX7A1; cytochrome c oxidase subunit 7A1; Cytochrome C Oxidase Subunit 7A1; Cytochrome C Oxidase Subunit VIIa Polypeptide 1 (Muscle); Cytochrome C Oxidase Subunit VIIa-H; Cytochrome C Oxidase Subunit VIIa-M; COX7AH; Cytochrome C Oxidase Subunit VIIa Heart/Muscle Isoform; Cytochrome C Oxidase Subunit 7A1, Mitochondrial; COX7AM; COX7A; cytochrome c oxidase subunit 7A1, mitochondrial; cytochrome c oxidase subunit VIIa heart/muscle isoform; cytochrome c oxidase subunit VIIa polypeptide 1 (muscle); cytochrome c oxidase subunit VIIa-H; cytochrome c oxidase subunit VIIa-M; cytochrome c oxidase subunit VIIa-heart; cytochrome c oxidase subunit VIIa-muscle; EC 1.9.3.1
Gene ID 1346
mRNA Refseq NM_001864
Protein Refseq NP_001855
MIM 123995
UniProt ID P24310

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All COX7A1 Products

Required fields are marked with *

My Review for All COX7A1 Products

Required fields are marked with *

0
cart-icon
0
compare icon