Recombinant Full Length Human Coxsackievirus And Adenovirus Receptor(Cxadr) Protein, His-Tagged
Cat.No. : | RFL672HF |
Product Overview : | Recombinant Full Length Human Coxsackievirus and adenovirus receptor(CXADR) Protein (P78310) (20-365aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (20-365) |
Form : | Lyophilized powder |
AA Sequence : | LSITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQKVDQVIILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKIHLVVLVKPSGARCYVDGSEEIGSDFKIKCEPKEGSLPLQYEWQKLSDSQKMPTSWLAEMTSSVISVKNASSEYSGTYSCTVRNRVGSDQCLLRLNVVPPSNKAGLIAGAIIGTLLALALIGLIIFCCRKKRREEKYEKEVHHDIREDVPPPKSRTSTARSYIGSNHSSLGSMSPSNMEGYSKTQYNQVPSEDFERTPQSPTLPPAKVAAPNLSRMGAIPVMIPAQSKDGSIV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CXADR |
Synonyms | CXADR; CAR; Coxsackievirus and adenovirus receptor; hCAR; CVB3-binding protein; Coxsackievirus B-adenovirus receptor; HCVADR |
UniProt ID | P78310 |
◆ Recombinant Proteins | ||
CXADR-438M | Recombinant Mouse Cxadr, ENLYFQ tagged | +Inquiry |
CXADR-247H | Recombinant Human coxsackie virus and adenovirus receptor, His-tagged | +Inquiry |
CXADR-1685R | Recombinant Rat CXADR Protein | +Inquiry |
CXADR-2153H | Recombinant Human CXADR Protein, GST-tagged | +Inquiry |
CXADR-48H | Recombinant Human CXADR Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXADR-1102MCL | Recombinant Mouse CXADR cell lysate | +Inquiry |
CXADR-1900HCL | Recombinant Human CXADR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CXADR Products
Required fields are marked with *
My Review for All CXADR Products
Required fields are marked with *
0
Inquiry Basket