Recombinant Full Length Human CREG1 Protein, C-Flag-tagged
Cat.No. : | CREG1-1188HFL |
Product Overview : | Recombinant Full Length Human CREG1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The adenovirus E1A protein both activates and represses gene expression to promote cellular proliferation and inhibit differentiation. The protein encoded by this gene antagonizes transcriptional activation and cellular transformation by E1A. This protein shares limited sequence similarity with E1A and binds both the general transcription factor TBP and the tumor suppressor pRb in vitro. This gene may contribute to the transcriptional control of cell growth and differentiation. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 23.9 kDa |
AA Sequence : | MAGLSRGSARALLAALLASTLLALLVSPARGRGGRDHGDWDEASRLPPLPPREDAARVARFVTHVSDWGA LATISTLEAVRGRPFADVLSLSDGPPGAGSGVPYFYLSPLQLSVSNLQENPYATLTMTLAQTNFCKKHGF DPQSPLCVHIMLSGTVTKVNETEMDIAKHSLFIRHPEMKTWPSSHNWFFAKLNITNIWVLDYFGGPKIVT PEEYYNVTVQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Secreted Protein, Transcription Factors, Transmembrane |
Full Length : | Full L. |
Gene Name | CREG1 cellular repressor of E1A stimulated genes 1 [ Homo sapiens (human) ] |
Official Symbol | CREG1 |
Synonyms | CREG |
Gene ID | 8804 |
mRNA Refseq | NM_003851.3 |
Protein Refseq | NP_003842.1 |
MIM | 618055 |
UniProt ID | O75629 |
◆ Recombinant Proteins | ||
CREG1-6439H | Recombinant Human CREG1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Creg1-531M | Recombinant Mouse Creg1, His tagged | +Inquiry |
Creg1-2307M | Recombinant Mouse Creg1 Protein, Myc/DDK-tagged | +Inquiry |
CREG1-2263H | Recombinant Human CREG1 Protein (Ser66-Asn196), N-His tagged | +Inquiry |
CREG1-5161Z | Recombinant Zebrafish CREG1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CREG1-1123MCL | Recombinant Mouse CREG1 cell lysate | +Inquiry |
CREG1-1069MCL | Recombinant Mouse CREG1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CREG1 Products
Required fields are marked with *
My Review for All CREG1 Products
Required fields are marked with *
0
Inquiry Basket