Recombinant Full Length Human CRIPT Protein, GST-tagged
| Cat.No. : | CRIPT-2059HF |
| Product Overview : | Human CRIPT full-length ORF ( NP_054890.1, 1 a.a. - 101 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 101 amino acids |
| Description : | This gene encodes a protein that binds to the PDZ3 peptide recognition domain. The encoded protein may modulates protein interactions with the cytoskeleton. A mutation in this gene resulted in short stature with microcephaly and distinctive facies. [provided by RefSeq, Jun 2014] |
| Molecular Mass : | 37.6 kDa |
| AA Sequence : | MVCEKCEKKLGTVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRICKSSVHQPGSHYCQGCAYKKGICAMCGKKVLDTKNYKQTSV |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CRIPT cysteine-rich PDZ-binding protein [ Homo sapiens ] |
| Official Symbol | CRIPT |
| Synonyms | CRIPT; cysteine-rich PDZ-binding protein; HSPC139; postsynaptic protein CRIPT; cysteine-rich interactor of PDZ3; cysteine-rich interactor of PDZ three |
| Gene ID | 9419 |
| mRNA Refseq | NM_014171 |
| Protein Refseq | NP_054890 |
| MIM | 604594 |
| UniProt ID | Q9P021 |
| ◆ Recombinant Proteins | ||
| CRIPT-6777H | Recombinant Human Cysteine-rich PDZ-binding Protein, His-tagged | +Inquiry |
| CRIPT-1879H | Recombinant Human CRIPT Protein, GST-tagged | +Inquiry |
| CRIPT-3908M | Recombinant Mouse CRIPT Protein | +Inquiry |
| CRIPT-1258R | Recombinant Rat CRIPT Protein, His (Fc)-Avi-tagged | +Inquiry |
| CRIPT-1601R | Recombinant Rat CRIPT Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CRIPT-201HCL | Recombinant Human CRIPT lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRIPT Products
Required fields are marked with *
My Review for All CRIPT Products
Required fields are marked with *
