Recombinant Full Length Human CRIPT Protein, GST-tagged

• Cat.No.: CRIPT-2059HF
• Product Overview: Human CRIPT full-length ORF ( NP_054890.1, 1 a.a. - 101 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 101 amino acids
• Description: This gene encodes a protein that binds to the PDZ3 peptide recognition domain. The encoded protein may modulates protein interactions with the cytoskeleton. A mutation in this gene resulted in short stature with microcephaly and distinctive facies. [provided by RefSeq, Jun 2014]
• Molecular Mass: 37.6 kDa
• AA Sequence: MVCEKCEKKLGTVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRICKSSVHQPGSHYCQGCAYKKGICAMCGKKVLDTKNYKQTSV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CRIPT cysteine-rich PDZ-binding protein [ Homo sapiens ]
• Official Symbol: CRIPT
• Synonyms: CRIPT; cysteine-rich PDZ-binding protein; HSPC139; postsynaptic protein CRIPT; cysteine-rich interactor of PDZ3; cysteine-rich interactor of PDZ three
• Gene ID: 9419
• mRNA Refseq: NM_014171
• Protein Refseq: NP_054890
• MIM: 604594
• UniProt ID: Q9P021