Recombinant Full Length Human CRIPT Protein, GST-tagged

Cat.No. : CRIPT-2059HF
Product Overview : Human CRIPT full-length ORF ( NP_054890.1, 1 a.a. - 101 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 101 amino acids
Description : This gene encodes a protein that binds to the PDZ3 peptide recognition domain. The encoded protein may modulates protein interactions with the cytoskeleton. A mutation in this gene resulted in short stature with microcephaly and distinctive facies. [provided by RefSeq, Jun 2014]
Molecular Mass : 37.6 kDa
AA Sequence : MVCEKCEKKLGTVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRICKSSVHQPGSHYCQGCAYKKGICAMCGKKVLDTKNYKQTSV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CRIPT cysteine-rich PDZ-binding protein [ Homo sapiens ]
Official Symbol CRIPT
Synonyms CRIPT; cysteine-rich PDZ-binding protein; HSPC139; postsynaptic protein CRIPT; cysteine-rich interactor of PDZ3; cysteine-rich interactor of PDZ three
Gene ID 9419
mRNA Refseq NM_014171
Protein Refseq NP_054890
MIM 604594
UniProt ID Q9P021

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CRIPT Products

Required fields are marked with *

My Review for All CRIPT Products

Required fields are marked with *

0
cart-icon
0
compare icon