Recombinant Full Length Human CRISP3 Protein, GST-tagged
Cat.No. : | CRISP3-2064HF |
Product Overview : | Human CRISP3 full-length ORF (BAG36185.1, 1 a.a. - 245 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 245 amino acids |
Description : | This gene encodes a member of the cysteine-rich secretory protein (CRISP) family within the CRISP, antigen 5 and pathogenesis-related 1 proteins superfamily. The encoded protein has an N-terminal CRISP, antigen 5 and pathogenesis-related 1 proteins domain, a hinge region, and a C-terminal ion channel regulator domain. This protein contains cysteine residues, located in both the N- and C-terminal domains, that form eight disulfide bonds, a distinguishing characteristic of this family. This gene is expressed in the male reproductive tract where it plays a role in sperm function and fertilization, and the female reproductive tract where it plays a role in endometrial receptivity for embryo implantation. This gene is upregulated in certain types of prostate cancer. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2016] |
Molecular Mass : | 53.35 kDa |
AA Sequence : | MTLFPVLLFLVAGLLPSFPANEDKDPAFTALLTTQTQVQREIVNKHNELRRAVSPPARNMLKMEWNKEAAANAQKWANQCNYRHSNPKDRMTSLKCGENLYMSSASSSWSQAIQSWFDEYNDFDFGVGPKTPNAVVGHYTQVVWYSSYLVGCGNAYCPNQKVLKYYYVCQYCPAGNWANRLYVPYEQGAPCASCPDNCDDGLCTNGCKYEDLYSNCKSLKLTLTCKHQLVRDSCKASCNCSNSIY |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CRISP3 cysteine-rich secretory protein 3 [ Homo sapiens ] |
Official Symbol | CRISP3 |
Synonyms | Aeg2; CRS3; SGP28; CRISP-3; dJ442L6.3 |
Gene ID | 10321 |
mRNA Refseq | NM_001190986 |
Protein Refseq | NP_001177915 |
MIM | 618062 |
UniProt ID | P54108 |
◆ Recombinant Proteins | ||
CRISP3-2735H | Recombinant Human CRISP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CRISP3-1680H | Recombinant Human CRISP3 Protein (Asn21-Tyr245), C-His tagged | +Inquiry |
CRISP3-3911M | Recombinant Mouse CRISP3 Protein | +Inquiry |
CRISP3-11580H | Recombinant Human CRISP3, GST-tagged | +Inquiry |
CRISP3-1679H | Recombinant Human CRISP3 Protein (Asn21-Ser243), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRISP3-7278HCL | Recombinant Human CRISP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CRISP3 Products
Required fields are marked with *
My Review for All CRISP3 Products
Required fields are marked with *
0
Inquiry Basket