Recombinant Full Length Human CRTAC1 Protein, His Tagged

Cat.No. : CRTAC1-001H
Product Overview : Recombinant Full Length Human CRTAC1 Protein (28-661 aa) with His Tag was expressed in HEK293.
Availability July 06, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 28-661 aa
Description : This gene encodes a glycosylated extracellular matrix protein that is found in the interterritorial matrix of articular deep zone cartilage. This protein is used as a marker to distinguish chondrocytes from osteoblasts and mesenchymal stem cells in culture. The presence of FG-GAP motifs and an RGD integrin-binding motif suggests that this protein may be involved in cell-cell or cell-matrix interactions. Copy number alterations in this gene have been observed in neurofibromatosis type 1-associated glomus tumors. Alternative splicing results in multiple transcript variants.
Molecular Mass : 70 kDa
AA Sequence : SQRAEPMFTAVTNSVLPPDYDSNPTQLNYGVAVTDVDHDGDFEIVVAGYNGPNLVLKYDRAQKRLVNIAVDERSSPYYALRDRQGNAIGVTACDIDGDGREEIYFLNTNNAFSGVATYTDKLFKFRNNRWEDILSDEVNVARGVASLFAGRSVACVDRKGSGRYSIYIANYAYGNVGPDALIEMDPEASDLSRGILALRDVAAEAGVSKYTGGRGVSVGPILSSSASDIFCDNENGPNFLFHNRGDGTFVDAAASAGVDDPHQHGRGVALADFNRDGKVDIVYGNWNGPHRLYLQMSTHGKVRFRDIASPKFSMPSPVRTVITADFDNDQELEIFFNNIAYRSSSANRLFRVIRREHGDPLIEELNPGDALEPEGRGTGGVVTDFDGDGMLDLILSHGESMAQPLSVFRGNQGFNNNWLRVVPRTRFGAFARGAKVVLYTKKSGAHLRIIDGGSGYLCEMEPVAHFGLGKDEASSVEVTWPDGKMVSRNVASGEMNSVLEILYPRDEDTLQDPAPLECGQGFSQQENGHCMDTNECIQFPFVCPRDKPVCVNTYGSYRCRTNKKCSRGYEPNEDGTACVGTLGQSPGPRPTTPTAAAATAAAAAAAGAATAAPVLVDGDLNLGSVVKESCEPSCHHHHHHHH
Endotoxin : < 1 EU/μg by LAL.
Purity : > 90 % by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH7.4
Concentration : 0.66 mg/mL by BCA
Gene Name CRTAC1 cartilage acidic protein 1 [ Homo sapiens (human) ]
Official Symbol CRTAC1
Synonyms CRTAC1; cartilage acidic protein 1; ASPIC; CEP68; LOTUS; ASPIC1; CEP-68; cartilage acidic protein 1; acidic secreted protein in cartilage; chondrocyte expressed protein 68 kDa CEP-68
Gene ID 55118
mRNA Refseq NM_018058
Protein Refseq NP_060528
MIM 606276
UniProt ID Q9NQ79

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CRTAC1 Products

Required fields are marked with *

My Review for All CRTAC1 Products

Required fields are marked with *

0
cart-icon