Recombinant Full Length Human CSNK1E Protein, C-Flag-tagged
Cat.No. : | CSNK1E-764HFL |
Product Overview : | Recombinant Full Length Human CSNK1E Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a serine/threonine protein kinase and a member of the casein kinase I protein family, whose members have been implicated in the control of cytoplasmic and nuclear processes, including DNA replication and repair. The encoded protein is found in the cytoplasm as a monomer and can phosphorylate a variety of proteins, including itself. This protein has been shown to phosphorylate period, a circadian rhythm protein. Two transcript variants encoding the same protein have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 47.1 kDa |
AA Sequence : | MELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLHIESKFYKMMQGGVGIPSIKW CGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGLGK KGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGS LPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQ GFSYDYVFDWNMLKFGAARNPEDVDRERREHEREERMGQLRGSATRALPPGPPTGATANRLRSAAEPVAS TPASRIQPAGNTSPRAISRVDRERKVSMRLHRGAPANVSSSDLTGRQEVSRIPASQTSVPFDHLGKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protein Kinase |
Protein Pathways : | Circadian rhythm - mammal, Hedgehog signaling pathway, Wnt signaling pathway |
Full Length : | Full L. |
Gene Name | CSNK1E casein kinase 1 epsilon [ Homo sapiens (human) ] |
Official Symbol | CSNK1E |
Synonyms | CKIe; HCKIE; CKIepsilon |
Gene ID | 1454 |
mRNA Refseq | NM_152221.3 |
Protein Refseq | NP_689407.1 |
MIM | 600863 |
UniProt ID | P49674 |
◆ Recombinant Proteins | ||
CSNK1E-1994H | Active Recombinant Human CSNK1E Protein, GST-tagged | +Inquiry |
CSNK1E-0202H | Recombinant Human CSNK1E Protein (E2-K416), Tag Free | +Inquiry |
CSNK1E-2746H | Recombinant Human CSNK1E protein, His-tagged | +Inquiry |
CSNK1E-2192HF | Recombinant Full Length Human CSNK1E Protein, GST-tagged | +Inquiry |
CSNK1E-1370H | Recombinant Human CSNK1E Protein (1-416 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSNK1E-7240HCL | Recombinant Human CSNK1E 293 Cell Lysate | +Inquiry |
CSNK1E-7239HCL | Recombinant Human CSNK1E 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CSNK1E Products
Required fields are marked with *
My Review for All CSNK1E Products
Required fields are marked with *
0
Inquiry Basket