Recombinant Full Length Human CST6 Protein, GST-tagged
| Cat.No. : | CST6-2239HF |
| Product Overview : | Human CST6 full-length ORF ( AAH31334, 29 a.a. - 149 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 149 amino acids |
| Description : | The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. This gene encodes a cystatin from the type 2 family, which is down-regulated in metastatic breast tumor cells as compared to primary tumor cells. Loss of expression is likely associated with the progression of a primary tumor to a metastatic phenotype. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 39.05 kDa |
| AA Sequence : | RPQERMVGELRDLSPDDPQVQKAAQAAVASYNMGSNSIYYFRDTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTRVTGDHVDLTTCPLAAGAQQEKLRCDFEVLVVPWQNSSQLLKHNCVQM |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CST6 cystatin E/M [ Homo sapiens ] |
| Official Symbol | CST6 |
| Synonyms | CST6; cystatin E/M; cystatin-M; cystatin 6; cystatin M; cystatin-6; cystatin-E; cystatin M/E; cysteine proteinase inhibitor |
| Gene ID | 1474 |
| mRNA Refseq | NM_001323 |
| Protein Refseq | NP_001314 |
| MIM | 601891 |
| UniProt ID | Q15828 |
| ◆ Recombinant Proteins | ||
| CST6-205H | Active Recombinant Human CST6 protein, His-tagged | +Inquiry |
| CST6-927M | Active Recombinant Mouse CST6 Protein, His-tagged | +Inquiry |
| Cst6-2346M | Recombinant Mouse Cst6 Protein, Myc/DDK-tagged | +Inquiry |
| Cst6-767M | Active Recombinant Mouse Cst6 Protein, His-tagged | +Inquiry |
| CST6-3352H | Recombinant Human CST6 Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CST6-1632MCL | Recombinant Mouse CST6 cell lysate | +Inquiry |
| CST6-2990HCL | Recombinant Human CST6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CST6 Products
Required fields are marked with *
My Review for All CST6 Products
Required fields are marked with *
