Recombinant Full Length Human CT45A3 Protein, GST-tagged

Cat.No. : CT45A3-2254HF
Product Overview : Human CT45-4 full-length ORF ( AAI53114.1, 1 a.a. - 189 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 189 amino acids
Description : CT45A3 (Cancer/Testis Antigen Family 45 Member A3) is a Protein Coding gene. An important paralog of this gene is CT45A6.
Molecular Mass : 47.19 kDa
AA Sequence : MTDKTEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKAKKLMTGHAIPPSQLDSQIDDFTGFSKDRMMQKPGSNAPVGGNVTSSFSGDDLECRETASSPKSQQEINADIKRKLVKELRCVGQKYEKIFEMLEGVQGPTAVRKRFFESIIKEAARCMRRDFVKHLKKKLKRMI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CT45A3 cancer/testis antigen family 45, member A3 [ Homo sapiens ]
Official Symbol CT45A3
Synonyms CT45A3; cancer/testis antigen family 45, member A3; cancer/testis antigen family 45 member A3; cancer/testis antigen CT45 3; CT45 3; CT45.3; Cancer/testis antigen 45-3; Cancer/testis antigen 45A3; Cancer/testis antigen family 45 member A3; CT453_HUMAN; CT45A3; cancer/testis antigen 45-3; cancer/testis antigen 45A3; cancer/testis antigen CT45-3; CT45-3; RP13-36C9.1; RP13-36C9.3
Gene ID 441519
mRNA Refseq NM_001017435
Protein Refseq NP_001017435
MIM 300794
UniProt ID Q8NHU0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CT45A3 Products

Required fields are marked with *

My Review for All CT45A3 Products

Required fields are marked with *

0
cart-icon