Recombinant Full Length Human CTDSP1 Protein, GST-tagged
Cat.No. : | CTDSP1-2224HF |
Product Overview : | Human CTDSP1 full-length ORF ( NP_872580.1, 1 a.a. - 260 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 260 amino acids |
Description : | This gene encodes a member of the small C-terminal domain phosphatase (SCP) family of nuclear phosphatases. These proteins play a role in transcriptional regulation through specific dephosphorylation of phosphoserine 5 within tandem heptapeptide repeats of the C-terminal domain of RNA polymerase II. The encoded protein plays a role in neuronal gene silencing in non-neuronal cells, and may also inhibit osteoblast differentiation. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Oct 2011] |
Molecular Mass : | 55.5 kDa |
AA Sequence : | MDSSAVITQISKEEARGPLRGKGDQKSAASQKPRSRGILHSLFCCVCRDDGEALPAHSGAPLLVEENGAIPKTPVQYLLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLSRVDDVYSVLRQPRPGS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CTDSP1 CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 1 [ Homo sapiens ] |
Official Symbol | CTDSP1 |
Synonyms | CTDSP1; CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 1; carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; NLIIF; nuclear LIM interactor interacting factor; SCP1; small CTD phosphatase 1; NLI-interacting factor 3; small C-terminal domain phosphatase 1; nuclear LIM interactor-interacting factor 3; NIF3; NLI-IF |
Gene ID | 58190 |
mRNA Refseq | NM_001206878 |
Protein Refseq | NP_001193807 |
MIM | 605323 |
UniProt ID | Q9GZU7 |
◆ Recombinant Proteins | ||
CTDSP1-2060H | Recombinant Human CTDSP1 Protein, GST-tagged | +Inquiry |
CTDSP1-1074R | Recombinant Rhesus monkey CTDSP1 Protein, His-tagged | +Inquiry |
CTDSP1-1387H | Recombinant Human CTDSP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CTDSP1-5120H | Recombinant Human CTDSP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CTDSP1-2224HF | Recombinant Full Length Human CTDSP1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTDSP1-7210HCL | Recombinant Human CTDSP1 293 Cell Lysate | +Inquiry |
CTDSP1-7211HCL | Recombinant Human CTDSP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTDSP1 Products
Required fields are marked with *
My Review for All CTDSP1 Products
Required fields are marked with *