Recombinant Full Length Human CTDSP1 Protein, GST-tagged

Cat.No. : CTDSP1-2224HF
Product Overview : Human CTDSP1 full-length ORF ( NP_872580.1, 1 a.a. - 260 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 260 amino acids
Description : This gene encodes a member of the small C-terminal domain phosphatase (SCP) family of nuclear phosphatases. These proteins play a role in transcriptional regulation through specific dephosphorylation of phosphoserine 5 within tandem heptapeptide repeats of the C-terminal domain of RNA polymerase II. The encoded protein plays a role in neuronal gene silencing in non-neuronal cells, and may also inhibit osteoblast differentiation. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Oct 2011]
Molecular Mass : 55.5 kDa
AA Sequence : MDSSAVITQISKEEARGPLRGKGDQKSAASQKPRSRGILHSLFCCVCRDDGEALPAHSGAPLLVEENGAIPKTPVQYLLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLSRVDDVYSVLRQPRPGS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CTDSP1 CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 1 [ Homo sapiens ]
Official Symbol CTDSP1
Synonyms CTDSP1; CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 1; carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; NLIIF; nuclear LIM interactor interacting factor; SCP1; small CTD phosphatase 1; NLI-interacting factor 3; small C-terminal domain phosphatase 1; nuclear LIM interactor-interacting factor 3; NIF3; NLI-IF
Gene ID 58190
mRNA Refseq NM_001206878
Protein Refseq NP_001193807
MIM 605323
UniProt ID Q9GZU7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CTDSP1 Products

Required fields are marked with *

My Review for All CTDSP1 Products

Required fields are marked with *

0
cart-icon
0
compare icon