Recombinant Full Length Human CTSW Protein, GST-tagged
Cat.No. : | CTSW-2364HF |
Product Overview : | Human CTSW full-length ORF ( AAH48255, 22 a.a. - 376 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 22-376 amino acids |
Description : | The protein encoded by this gene, a member of the peptidase C1 family, is a cysteine proteinase that may have a specific function in the mechanism or regulation of T-cell cytolytic activity. The encoded protein is found associated with the membrane inside the endoplasmic reticulum of natural killer and cytotoxic T-cells. Expression of this gene is up-regulated by interleukin-2. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 64.79 kDa |
AA Sequence : | IRGPLRAQDLGPQPLELKEAFKLFQIQFNRSYLSPEEHAHRLDIFAHNLAQAQRLQEEDLGTAEFGVTPFSDLTEEEFGQLYGYRRAAGGVPSMGREIRSEEPEESVPFSCDWRKVAGAISPIKDQKNCNCCWAMAAAGNIETLWRISFWDFVDVSVQELLDCGRCGDGCHGGFVWDAFITVLNNSGLASEKDYPFQGKVRAHRCHPKKYQKVAWIQDFIMLQNNEHRIAQYLATYGPITVTINMKPLQLYRKGVIKATPTTCDPQLVDHSVLLVGFGSVKSEEGIWAETVSSQSQPQPPHPTPYWILKNSWGAQWGEKGYFRLHRGSNTCGITKFPLTARVQKPDMKPRVSCPP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CTSW cathepsin W [ Homo sapiens ] |
Official Symbol | CTSW |
Synonyms | CTSW; cathepsin W; cathepsin W (lymphopain); lymphopain; LYPN; |
Gene ID | 1521 |
mRNA Refseq | NM_001335 |
Protein Refseq | NP_001326 |
MIM | 602364 |
UniProt ID | P56202 |
◆ Recombinant Proteins | ||
Ctsw-2768M | Recombinant Mouse Ctsw protein, His&Myc-tagged | +Inquiry |
CTSW-8183H | Recombinant Human CTSW protein, His & T7-tagged | +Inquiry |
CTSW-2364HF | Recombinant Full Length Human CTSW Protein, GST-tagged | +Inquiry |
CTSW-404H | Recombinant Human cathepsin W, His-tagged | +Inquiry |
CTSW-1894H | Recombinant Human CTSW Protein (Ile22-Pro376), N-His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTSW Products
Required fields are marked with *
My Review for All CTSW Products
Required fields are marked with *
0
Inquiry Basket