Recombinant Full Length Human CXADR Protein
Cat.No. : | CXADR-105HF |
Product Overview : | Recombinant full length Human Coxsackie Adenovirus Receptor with an N terminal proprietary tag; Predicted MWt 66.26 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 365 amino acids |
Description : | The protein encoded by this gene is a type I membrane receptor for group B coxsackieviruses and subgroup C adenoviruses. Several transcript variants encoding different isoforms have been found for this gene. Pseudogenes of this gene are found on chromosomes 15, 18, and 21. |
Form : | Liquid |
Molecular Mass : | 66.260kDa inclusive of tags |
AA Sequence : | MALLLCFVLLCGVVDFARSLSITTPEEMIEKAKGETAYLP CKFTLSPEDQGPLDIEWLISPADNQKVDQVIILYSGDKIY DDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQC KVKKAPGVANKKIHLVVLVKPSGARCYVDGSEEIGSDFKI KCEPKEGSLPLQYEWQKLSDSQKMPTSWLAEMTSSVISVK NASSEYSGTYSCTVRNRVGSDQCLLRLNVVPPSNKAGLIA GAIIGTLLALALIGLIIFCCRKKRREEKYEKEVHHDIRED VPPPKSRTSTARSYIGGNHSSLGSMSPSNMEGYSKTQYNQ VPSEDFERTPQSPTLPPAKVAAPNLSRMGAIPVMIPAQSK DGSIV |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | CXADR coxsackie virus and adenovirus receptor [ Homo sapiens ] |
Official Symbol | CXADR |
Synonyms | CXADR; coxsackie virus and adenovirus receptor; coxsackievirus and adenovirus receptor; CAR |
Gene ID | 1525 |
mRNA Refseq | NM_001207063 |
Protein Refseq | NP_001193992 |
MIM | 602621 |
UniProt ID | P78310 |
◆ Recombinant Proteins | ||
CXADR-247H | Recombinant Human coxsackie virus and adenovirus receptor, His-tagged | +Inquiry |
Cxadr-676M | Active Recombinant Mouse Cxadr protein(Met1-Gly237), His&hFc-tagged | +Inquiry |
CXADR-3854H | Recombinant Human CXADR protein, His-tagged | +Inquiry |
CXADR-1344R | Recombinant Rat CXADR Protein, His (Fc)-Avi-tagged | +Inquiry |
Cxadr-382M | Active Recombinant Mouse Coxsackie Virus And Adenovirus Receptor | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXADR-1900HCL | Recombinant Human CXADR cell lysate | +Inquiry |
CXADR-1102MCL | Recombinant Mouse CXADR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXADR Products
Required fields are marked with *
My Review for All CXADR Products
Required fields are marked with *