Recombinant Full Length Human CXADR Protein
Cat.No. : | CXADR-105HF |
Product Overview : | Recombinant full length Human Coxsackie Adenovirus Receptor with an N terminal proprietary tag; Predicted MWt 66.26 kDa. |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene is a type I membrane receptor for group B coxsackieviruses and subgroup C adenoviruses. Several transcript variants encoding different isoforms have been found for this gene. Pseudogenes of this gene are found on chromosomes 15, 18, and 21. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 66.260kDa inclusive of tags |
Protein Length : | 365 amino acids |
AA Sequence : | MALLLCFVLLCGVVDFARSLSITTPEEMIEKAKGETAYLP CKFTLSPEDQGPLDIEWLISPADNQKVDQVIILYSGDKIY DDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQC KVKKAPGVANKKIHLVVLVKPSGARCYVDGSEEIGSDFKI KCEPKEGSLPLQYEWQKLSDSQKMPTSWLAEMTSSVISVK NASSEYSGTYSCTVRNRVGSDQCLLRLNVVPPSNKAGLIA GAIIGTLLALALIGLIIFCCRKKRREEKYEKEVHHDIRED VPPPKSRTSTARSYIGGNHSSLGSMSPSNMEGYSKTQYNQ VPSEDFERTPQSPTLPPAKVAAPNLSRMGAIPVMIPAQSK DGSIV |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | CXADR coxsackie virus and adenovirus receptor [ Homo sapiens ] |
Official Symbol : | CXADR |
Synonyms : | CXADR; coxsackie virus and adenovirus receptor; coxsackievirus and adenovirus receptor; CAR |
Gene ID : | 1525 |
mRNA Refseq : | NM_001207063 |
Protein Refseq : | NP_001193992 |
MIM : | 602621 |
UniProt ID : | P78310 |
Products Types
◆ Recombinant Protein | ||
CXADR-2153H | Recombinant Human CXADR Protein, GST-tagged | +Inquiry |
Cxadr-10532M | Recombinant Mouse Cxadr Protein, His (Fc)-Avi-tagged | +Inquiry |
Cxadr-676M | Active Recombinant Mouse Cxadr protein(Met1-Gly237), His&hFc-tagged | +Inquiry |
CXADR-001H | Active Recombinant Human CXADR Protein, Fc-tagged | +Inquiry |
CXADR-1344R | Recombinant Rat CXADR Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
CXADR-1102MCL | Recombinant Mouse CXADR cell lysate | +Inquiry |
CXADR-1900HCL | Recombinant Human CXADR cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All CXADR Products
Required fields are marked with *
My Review for All CXADR Products
Required fields are marked with *
0
Inquiry Basket