Recombinant Full Length Human CYB561D1 Protein, GST-tagged
| Cat.No. : | CYB561D1-2376HF |
| Product Overview : | Human CYB561D1 full-length ORF (BAC04767.1, 1 a.a. - 229 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 229 amino acids |
| Description : | CYB561D1 (Cytochrome B561 Family Member D1) is a Protein Coding gene. An important paralog of this gene is CYB561D2. |
| Molecular Mass : | 51.8 kDa |
| AA Sequence : | MQPLEVGLVPAPAGEPRLTRWLRRGSGILAHLVALGFTIFLTALSRPGTSLFSWHPVFMALAFCLCMAEAILLFSPEHSLFFFCSRKARIRLHWAGQTLAILCAALGLGFIISSRTRSELPHLVSWHSWVGALTLLATAVQALCGLCLLCPRAARVSRVARLKLYHLTCGLVVYLMATVTVLLGMYSVWFQAQIKGAAWYLCLALPVYPALVIMHQISRSYLPRKKMEM |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CYB561D1 cytochrome b-561 domain containing 1 [ Homo sapiens ] |
| Official Symbol | CYB561D1 |
| Synonyms | RP5-831G13.3 |
| Gene ID | 284613 |
| mRNA Refseq | NM_182580.2 |
| Protein Refseq | NP_872386.1 |
| UniProt ID | Q8N8Q1 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYB561D1 Products
Required fields are marked with *
My Review for All CYB561D1 Products
Required fields are marked with *




