Recombinant Full Length Human CYB5B Protein, GST-tagged

Cat.No. : CYB5B-2382HF
Product Overview : Human CYB5-M full-length ORF ( AAH04373.1, 1 a.a. - 146 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 146 amino acids
Description : CYB5B (Cytochrome B5 Type B) is a Protein Coding gene. Among its related pathways are Cytochrome P450 - arranged by substrate type and Metabolism. GO annotations related to this gene include heme binding and enzyme activator activity. An important paralog of this gene is CYB5A.
Molecular Mass : 42.7 kDa
AA Sequence : MATAEASGSDGKGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKDPSKNDTCKSCWAYWILPIIGAVLLGFLYRYYTSESKSS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CYB5B cytochrome b5 type B (outer mitochondrial membrane) [ Homo sapiens ]
Official Symbol CYB5B
Synonyms CYB5B; cytochrome b5 type B (outer mitochondrial membrane); cytochrome b5 type B; CYB5 M; type 2 cyt-b5; outer mitochondrial membrane cytochrome b5; cytochrome b5 outer mitochondrial membrane isoform; OMB5; CYB5-M; CYPB5M; DKFZp686M0619;
Gene ID 80777
mRNA Refseq NM_030579
Protein Refseq NP_085056
MIM 611964
UniProt ID O43169

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (1)

Customer Reviews

Write a review

Q&As

Ask a question

Is there an iron or heme content for this particular product? 12/01/2023

The culture medium contains trace elements such as iron (Fe). In theory, these elements should be incorporated into the structure. However, this has not been experimentally verified on the final product.

Ask a Question for All CYB5B Products

Required fields are marked with *

My Review for All CYB5B Products

Required fields are marked with *

0
cart-icon
0
compare icon