Recombinant Full Length Human CYB5R2 Protein, GST-tagged

• Cat.No.: CYB5R2-2384HF
• Product Overview: Human CYB5R2 full-length ORF ( AAH01346.1, 1 a.a. - 237 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 237 amino acids
• Description: The protein encoded by this gene belongs to the flavoprotein pyridine nucleotide cytochrome reductase family of proteins. Cytochrome b-type NAD(P)H oxidoreductases are implicated in many processes including cholesterol biosynthesis, fatty acid desaturation and elongation, and respiratory burst in neutrophils and macrophages. Cytochrome b5 reductases have soluble and membrane-bound forms that are the product of alternative splicing. In animal cells, the membrane-bound form binds to the endoplasmic reticulum, where it is a member of a fatty acid desaturation complex. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2014]
• Molecular Mass: 53.4 kDa
• AA Sequence: MNSRRREPITLQDPEAKYPLPLIEKEKISHNTRRFRFGLPSPDHVLGLPVGNYVQLLAKIDNELVVRAYTPVSSDDDRGFVDLIIKIYFKNVHPQYPEGGKMTQYLENMKIGETIFFRGPRGRLFYHGPGNLGIRPDQTSEPKKTLADHLGMIAGGTGITPMLQLIRHITKDPSDRTRMSLIFANQTEEDILVRKELEEIARTHPDQFDLWYTLDRPPIGPWSAEGATLLSNSAQFH
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CYB5R2 cytochrome b5 reductase 2 [ Homo sapiens ]
• Official Symbol: CYB5R2
• Synonyms: CYB5R2; cytochrome b5 reductase 2; NADH-cytochrome b5 reductase 2; cytochrome b5 reductase b5R.2; B5R.2
• Gene ID: 51700
• mRNA Refseq: NM_016229
• Protein Refseq: NP_057313
• MIM: 608342
• UniProt ID: Q6BCY4