Recombinant Full Length Human CYS1 Protein, GST-tagged

• Cat.No.: CYS1-2487HF
• Product Overview: Human CYS1 full-length ORF ( AAI48589.1, 1 a.a. - 158 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 158 amino acids
• Description: CYS1 (Cystin 1) is a Protein Coding gene. Diseases associated with CYS1 include Astereognosia and Yellow Nail Syndrome. Among its related pathways are Cargo trafficking to the periciliary membrane and Organelle biogenesis and maintenance.
• Molecular Mass: 43.78 kDa
• AA Sequence: MGSGSSRSSRTLRRRRSPESLPAGPGAAALEGGTRRRVPVAAAEVPGAAAEEAPGRDPSPVAPPDGRDETLRLLDELLAESAAWGPPEPAPRRPARLRPTAVAGSAVCAEQSTEGHPGSGNVSEAPGSGRKKPERPAAISYDHSEEGLMASIEREYCR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CYS1 cystin 1 [ Homo sapiens (human) ]
• Official Symbol: CYS1
• Synonyms: cystin-1; cilia-associated protein; CYS1
• Gene ID: 192668
• mRNA Refseq: NM_001037160.2
• Protein Refseq: NP_001032237.1
• MIM: 618713
• UniProt ID: Q717R9