Recombinant Full Length Human CYS1 Protein, GST-tagged

Cat.No. : CYS1-2487HF
Product Overview : Human CYS1 full-length ORF ( AAI48589.1, 1 a.a. - 158 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 158 amino acids
Description : CYS1 (Cystin 1) is a Protein Coding gene. Diseases associated with CYS1 include Astereognosia and Yellow Nail Syndrome. Among its related pathways are Cargo trafficking to the periciliary membrane and Organelle biogenesis and maintenance.
Molecular Mass : 43.78 kDa
AA Sequence : MGSGSSRSSRTLRRRRSPESLPAGPGAAALEGGTRRRVPVAAAEVPGAAAEEAPGRDPSPVAPPDGRDETLRLLDELLAESAAWGPPEPAPRRPARLRPTAVAGSAVCAEQSTEGHPGSGNVSEAPGSGRKKPERPAAISYDHSEEGLMASIEREYCR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CYS1 cystin 1 [ Homo sapiens (human) ]
Official Symbol CYS1
Synonyms cystin-1; cilia-associated protein; CYS1
Gene ID 192668
mRNA Refseq NM_001037160.2
Protein Refseq NP_001032237.1
MIM 618713
UniProt ID Q717R9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CYS1 Products

Required fields are marked with *

My Review for All CYS1 Products

Required fields are marked with *

0
cart-icon
0
compare icon