Recombinant Full Length Human CYSLTR2 Protein
| Cat.No. : | CYSLTR2-2490HF | 
| Product Overview : | Human CYSLTR2 full-length ORF (NP_065110.1) recombinant protein without tag. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Protein Length : | 346 amino acids | 
| Description : | The cysteinyl leukotrienes LTC4, LTD4, and LTE4 are important mediators of human bronchial asthma. Pharmacologic studies have determined that cysteinyl leukotrienes activate at least 2 receptors, the protein encoded by this gene and CYSLTR1. This encoded receptor is a member of the superfamily of G protein-coupled receptors. It seems to play a major role in endocrine and cardiovascular systems. [provided by RefSeq, Jul 2008] | 
| Form : | Liquid | 
| Molecular Mass : | 39.6 kDa | 
| AA Sequence : | MERKFMSLQPSISVSEMEPNGTFSNNNSRNCTIENFKREFFPIVYLIIFFWGVLGNGLSIYVFLQPYKKSTSVNVFMLNLAISDLLFISTLPFRADYYLRGSNWIFGDLACRIMSYSLYVNMYSSIYFLTVLSVVRFLAMVHPFRLLHVTSIRSAWILCGIIWILIMASSIMLLDSGSEQNGSVTSCLELNLYKIAKLQTMNYIALVVGCLLPFFTLSICYLLIIRVLLKVEVPESGLRVSHRKALTTIIITLIIFFLCFLPYHTLRTVHLTTWKVGLCKDRLHKALVITLALAAANACFNPLLYYFAGENFKDRLKSALRKGHPQKAKTKCVFPVSVWLRKETRV | 
| Applications : | Antibody Production Functional Study Compound Screening | 
| Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. | 
| Gene Name | CYSLTR2 cysteinyl leukotriene receptor 2 [ Homo sapiens ] | 
| Official Symbol | CYSLTR2 | 
| Synonyms | HG57; CYSLT2; HPN321; CYSLT2R; KPG_011; hGPCR21; PSEC0146 | 
| Gene ID | 57105 | 
| mRNA Refseq | NM_020377.2 | 
| Protein Refseq | NP_065110.1 | 
| MIM | 605666 | 
| UniProt ID | Q9NS75 | 
| ◆ Recombinant Proteins | ||
| CYSLTR2-1420R | Recombinant Rat CYSLTR2 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| RFL18283RF | Recombinant Full Length Rat Cysteinyl Leukotriene Receptor 2(Cysltr2) Protein, His-Tagged | +Inquiry | 
| CYSLTR2-4249M | Recombinant Mouse CYSLTR2 Protein | +Inquiry | 
| RFL4789SF | Recombinant Full Length Pig Cysteinyl Leukotriene Receptor 2(Cysltr2) Protein, His-Tagged | +Inquiry | 
| CYSLTR2-2490HF | Recombinant Full Length Human CYSLTR2 Protein | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CYSLTR2-7096HCL | Recombinant Human CYSLTR2 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYSLTR2 Products
Required fields are marked with *
My Review for All CYSLTR2 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            