Recombinant Full Length Human CYTL1 Protein, GST-tagged

Cat.No. : CYTL1-2507HF
Product Overview : Human CYTL1 full-length ORF ( AAH31391, 1 a.a. - 136 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 136 amino acids
Description : C17 is a cytokine-like protein specifically expressed in bone marrow and cord blood mononuclear cells that bear the CD34 (MIM 142230) surface marker (Liu et al., 2000 [PubMed 10857752]).[supplied by OMIM, Mar 2008]
Molecular Mass : 40.7 kDa
AA Sequence : MRTPGPLPVLLLLLAGAPAARPTPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNALEYPIPVTTALPDRQR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CYTL1 cytokine like 1 [ Homo sapiens (human) ]
Official Symbol CYTL1
Synonyms CYTL1; cytokine like 1; Cytokine Like 1; C4orf4; Cytokine-Like Protein C17; Cytokine-Like Protein 1; Cytokine-Like 1; Protein C17; C17; cytokine-like protein 1; cytokine-like protein C17
Gene ID 54360
mRNA Refseq NM_018659
Protein Refseq NP_061129
MIM 607930
UniProt ID Q9NRR1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CYTL1 Products

Required fields are marked with *

My Review for All CYTL1 Products

Required fields are marked with *

0
cart-icon
0
compare icon